Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "bruce"

1. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

2. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

3. Today, Bruce Lee's legacy continues to be felt around the world

Random Sentences

1. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

2. He has been practicing yoga for years.

3.

4. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

5. Ang pagiging makapamilya ay isa sa pinakamagandang katangian ng mga Pinoy.

6. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

7. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

8. The exchange of rings is a common tradition in many weddings.

9. Sa bukirin, naglipana ang mga tanim ng mais.

10. Mahirap makita ang liwanag sa gitna ng mailap na kadiliman.

11. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

12. Matagal na napako ang kanyang tingin kay Kano, ang sumunod sa kanya.

13. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

14. High blood pressure is more common in older adults and those with certain medical conditions.

15. Ano ba problema mo? Bakit ba ayaw mong magpa-ospital?!

16. Alas tres ang alis ng tren tuwing hapon.

17. Las plantas con flores se reproducen a través de la polinización, en la que los insectos u otros agentes transportan el polen.

18. Kanino humingi ng tulong ang mga tao?

19. Hindi siya nag-aral para sa pagsusulit, samakatuwid, bumagsak siya.

20. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

21. Different? Ako? Hindi po ako martian.

22. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

23. Danmark eksporterer mange forskellige varer til lande over hele verden.

24. Gusto kong matutong tumugtog ng gitara.

25. Money can take many forms, including cash, bank deposits, and digital currencies.

26. My coworkers threw me a surprise party and sang "happy birthday" to me.

27. Hindi na niya makuhang laruin ang beyblade bagamat ayaw niya itong bitiwan sa loob ng kaniyang kamay o di kaya'y bulsa.

28. El invierno es la estación más fría del año.

29. Puwede ba bumili ng tiket dito?

30. Saan naman? Sa sine o DVD na lang? tanong ko.

31. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

32. Lazada's mobile app is popular among customers, with over 70 million downloads.

33. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

34. Kailangang magluto ng kanin ni Pedro.

35. Mahalaga ang pag-aaral sa talambuhay ni Teresa Magbanua upang maipakita ang papel ng kababaihan sa himagsikan.

36. Nakahiga ako sa gabi nang biglang magkaroon ng malakas na kidlat at nagitla ako sa takot.

37. The baby is not crying at the moment.

38. The website has a chatbot feature that allows customers to get immediate assistance.

39. Ngumiti muna siya sa akin saka sumagot.

40. Work is a necessary part of life for many people.

41. Maganda ang bansang Singapore.

42. La esperanza es un regalo que debemos valorar y compartir con los demás. (Hope is a gift that we should cherish and share with others.)

43. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

44. Es importante tener amigos que nos apoyen y nos escuchen.

45. Sira ang elevator sa mall, kaya't napilitan silang gamitin ang hagdan.

46. The culprit behind the product recall was found to be a manufacturing defect.

47. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

48. The journalist interviewed a series of experts for her investigative report.

49. The flowers are not blooming yet.

50. Mabilis na lumipad ang paniki palabas ng kweba.

Recent Searches

imaginationpulabruceinsteadtutorialsjunjunsequemetodenaggingbadingcommerceknowauthoremphasisabsviewsdaigdignag-aaralobra-maestramayornerissaisinuotmasterrecentmakakasahodnagpapaniwalapapalapitkotsehaltnegro-slaveskumikinigflyinjurytv-showskare-karenanlalamigpinagmamasdanuulaminnakakaanimsapatosnaglulusakplanning,tamadganangmaingathaytenernakaluhodpaskocivilizationamongfriesanimobiggestdidpartdalawangpagtiisanpapagalitannakapagsabitatayonagpatuloyisinulatmarketplacesnakatayonakatunghaypanghabambuhaykahirapangodtnatulogtaasdinanastelanagliliyabcultivogobernadortinulak-tulakkumukuhanageespadahansinasadyakumikilosdisenyongminu-minutokonsultasyonmakidalokapasyahannagpalalimpanalanginkasokagipitannamataypangangatawanpumitaskalalaromagtataasromanticismobabasahiniloilomoviekatutubokolehiyonaglahopagsahodmahinanapapansinlumayomagpagupithalu-halocombatirlas,industriyacountrynapakabilisbasketbolumikotkastilangdropshipping,magdamagopisinakuripotkassingulangkindergartenkilaypagbatinaghubadnatitiyakmagisipsementongjeepneyadvancementpigilanmanonoodlagaslasmasukolnuevoroofstockginoongnakainendvideredyosamemorysakennamilipitexpresannaismaongiyakkulangbesesbinatilyobutireynasellingbagamaumigibomfattendedadaloanumankainanbanlagmalilimutankakayananmarinigpinoyisubosumigawbusytignanmalumbaymedyostoapoyoutlineadvancebumabagibinalitangtaga-suportaupworkevenpinilingumilingbeginningbrideipasokfuncionarrateexperiencesactingbotopetsangblazingmahahabasipasigebasahinsupilinsamakatwidpresyotiketbernardokatabing