Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "bruce"

1. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

2. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

3. Today, Bruce Lee's legacy continues to be felt around the world

Random Sentences

1. Nangumbida ako ng maraming tao kasabay ng biling 'wag kalimutan ang regalo at pagbati ng �Happy Birthday,Rebo!�

2. Hansel and Gretel find themselves lost in the woods and stumble upon a gingerbread house owned by a wicked witch.

3. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

4. Ang punong-kahoy ay nagbibigay ng sapat na lilim para sa mga nilalang na nabubuhay sa ilalim nito.

5. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

6. Nakangiti sya habang nakatayo ako at nagtataka.

7. The lightweight construction of the bicycle made it ideal for racing.

8. Twinkle, twinkle, all the night.

9. Nationalism is often associated with symbols such as flags, anthems, and monuments.

10. Los blogs y los vlogs son una forma popular de compartir información en línea.

11. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

12. Sayang, tolong maafkan aku jika aku pernah salah. (Darling, please forgive me if I ever did wrong.)

13. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

14. Ikinagagalak kong malaman na natupad mo na ang iyong mga pangarap.

15. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

16. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

17. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

18. Lumaganap ang panaghoy ng mga magsasaka dahil sa kakulangan ng tubig para sa kanilang pananim.

19. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

20. Natandaan niya ang mga panunuksong iyon.

21. The authorities were stumped as to who the culprit could be in the unsolved case.

22. Larry Bird was a versatile forward and one of the best shooters in NBA history.

23. Dahil sa tag-ulan, ang temperatura ng panahon ay kadalasang mas malamig at mas nakakapalamig.

24. Kucing juga dikenal sebagai pembasmi tikus dan serangga di rumah atau tempat tinggal.

25. Masama pa ba ang pakiramdam mo?

26. Dumilat siya saka tumingin saken.

27. Sa pagguhit, mahalaga ang pagpili ng tamang anggulo at perspektiba.

28. Malamang na tamaan ka pa ng kidlat.

29. Kucing di Indonesia juga dikenal dengan sebutan "meong" atau "ngomong" karena suaranya yang unik.

30. Kumain na ako pero gutom pa rin ako.

31. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

32. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

33. Si Mabini ay naging pangalawang pangulo ng unang Republika ng Pilipinas.

34.

35. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

36. Ako po si Maico. nakangiting sabi niya.

37. Sa gitna ng katahimikan, nakita ko siyang tulala sa kanyang pag-iisip.

38. Kucing dapat dilatih untuk melakukan beberapa trik seperti menjulurkan tangan untuk berjabat tangan atau melompat melalui ring.

39. Pagkatapos kong ipagbili ito, bibili ako ng pagkain natin.

40. Ada banyak komunitas pecinta kucing di Indonesia yang berkumpul untuk berbagi pengalaman dan pengetahuan tentang kucing.

41. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

42. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

43. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

44. And often through my curtains peep

45. Inakalang totoong kaibigan ang kasama niya, pero pinagsisinungalingan siya.

46. Hinahabol ko ang aking hiningang mahina dahil sa kalagitnaan ng marathon.

47. Durante la época renacentista, se desarrollaron las primeras formas de música instrumental, como la guitarra y el clavicémbalo

48. Wag kang magtatanim ng sama ng loob sa kapwa.

49. L'accès à des soins de santé de qualité peut avoir un impact important sur la santé et le bien-être des populations.

50. Ang ilalim ng kanyang payong ay nagsilbing lilim mula sa malakas na sikat ng araw.

Recent Searches

brucewellcoaching:desdecebuideyaehehedrinkbabedressdreamdoingdiyanaralrepresentativesupportcabledinigactivityworkingdilimredhapasinfiguresheideresgrandennedavaodarnadancedaangstrengthcourtcloseclockchesskampeonkakaibanalasingkasingtigasbuwanexhaustionbuwalbutilusedbutchkumatokindustriyabuongbunsoulobuhaysofabuenabreakbrasogenerositybiyakmaibalikbirdstabingchefbingocanadabilaobigaybigaspagbeastbeachbasedkapaligiranbaliwpakainbalakbagalnilinisbaduybaboysinongauditareasaraw-nabubuhayanongi-marke-booksaninobellambagakalaahhhhadobocoalibonabonoabena1970s1960sdali-dalingmagdayongmatikmanumagatryghedyearsakayxviiagostoconvertingwordkanayangumibigriegaentrygeneratekisapmataarbejdermalambotimprovedvigtigsteanibersaryomaipantawid-gutomshowmanlalakbaykinikitanakatunghaymagpa-checkuppaglulutosaan-saannagtrabahonaiinitanmagsasakamauliniganenfermedadeswalletnakabluepaki-basakonsultasyoninilabasnapasigawnagbantaydisenyonguugud-ugoduuwilever,naguguluhansisikatmerlindanagliwanagnahigitanpaladpepenakayukopinalalayaspagdukwangmagkanoalas-dostodaybumibitiwkahongeverysumagotradionakihalubilobataokayumokaysoccerpinsanpakistantrennagpasamailocosdisyembrebaryoleftbecamepatiencemapuputilunesmaitimatensyonbumahaeffortspagtatanghalkartondettesang-ayonboxbatokkanananimwalkie-talkiedumilimmabatonginantoktatanggapinpay