Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

32 sentences found for "day"

1. "Every dog has its day."

2. A couple of cups of coffee in the morning help me start my day.

3. Ano ang ginugunita sa Thanksgiving Day?

4. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

5. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

6. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

7. Guten Tag! - Good day!

8. Happy birthday to my best friend, I hope you have a wonderful day!

9. He does not play video games all day.

10. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

11. Hendes smil kan lyse op en hel dag. (Her smile can light up an entire day.)

12. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

13. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

14. I have been jogging every day for a week.

15. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

16. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

17. I took the day off from work to relax on my birthday.

18. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

19. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

20. Many people start their day with a cup of coffee to help them wake up and feel more alert.

21. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

22. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

23. Schönen Tag noch! - Have a nice day!

24. She has been baking cookies all day.

25. She has been exercising every day for a month.

26. She has been working in the garden all day.

27. She surprised me with a cake on my last day of work to bid me farewell.

28. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

29. The tree provides shade on a hot day.

30. The wedding photographer captures important moments and memories from the wedding day.

31. They have been cleaning up the beach for a day.

32. They walk to the park every day.

Random Sentences

1. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

2. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

3. Ito ang nabigkas ni Waldo, mga katagang mula sa kanyang puso na punong-puno ng hinanakit.

4. Samantala sa kanyang pag-aaral ng sining, nagpapahayag siya ng kanyang mga damdamin sa pamamagitan ng mga likhang sining.

5. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

6. Napakalakas ng bagyong tumama sa kanilang bayan.

7. Las hojas de los árboles proporcionan sombra y protección contra el sol.

8. Ang pangamba ay maaaring maging dahilan ng hindi pagpunta sa mga lugar na hindi pamilyar sa atin.

9. Ang mga bayani ay nagturo sa mga kabataan ng mga aral at kahalagahan ng pagsisilbi sa bayan.

10. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

11. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

12. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

13. D'you know what time it might be?

14. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

15. Nang suriin nila ito ay nakita ang isang insektong kumakain ng kahoy.

16. Bumisita ako sa lola ko noong Mayo.

17. Ang pagpapalaganap ng mga konspirasyon at teorya ng kung ano-ano ay nagpapakita ng pagiging bulag sa katotohanan.

18. The character in the movie was content in his simple life, believing that ignorance is bliss.

19. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

20. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

21. Ang nagdudumaling laro ng chess ay nangangailangan ng matinding kasanayan sa pagtatanghal ng mga hakbang at galaw.

22. He is not running in the park.

23. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

24. Budgeting, saving, and investing are important aspects of money management.

25. Gabi na natapos ang prusisyon.

26. Ang mga mag-aaral ay nag-aapuhap ng karagdagang oras para mag-ensayo para sa kanilang mga pagsusulit.

27. Sa gitna ng dilim, natagpuan niya ang liwanag sa pamamagitan ng pag-iisa.

28. How I wonder what you are.

29. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

30. Ano pa ho ang dapat kong gawin?

31. Sa bawat panaghoy ng mga nagugutom, pilit nilang itinataguyod ang kanilang pamilya.

32. Ano ho ang tingin niyo sa condo na ito?

33. Nag-aaral siya sa library gabi-gabi.

34. Sayang, tolong ambilkan aku air minum. (Darling, please get me a glass of water.)

35. I don't think we've met before. May I know your name?

36. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

37. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

38. Su obra más famosa es la escultura del David en Florencia.

39. Hindi dapat umasa sa mailap na mga pangako ng ibang tao.

40. Matapos ang kanyang tagumpay, si Hidilyn Diaz ay tumanggap ng maraming parangal mula sa gobyerno at pribadong sektor.

41. Tila may pagdududa siya sa katapatan ng kanyang kaibigan.

42. La persona ebria en la calle está llamando la atención de los transeúntes.

43. Mag o-online ako mamayang gabi.

44. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

45. The children are playing with their toys.

46. Nakita kita sa isang magasin.

47. Tinuro ng aking lola kung paano magluto ng suman gamit ang pulotgata.

48. Wait lang ha, sasagutin ko na baka importante eh.

49. Inflation kann auch durch eine Erhöhung der Arbeitskosten verursacht werden.

50. Ang galing nya maglaro ng mobile legends.

Similar Words

birthdayPa-dayagonalSaturdayWednesdayFridaynandayaTodayworkdaydays

Recent Searches

dayballtitiratumawaginirapanpisaranamumukod-tangipinagkaloobanbayangfotosressourcernetinakasankumalmagandahankasiyahanpangingiminalamankumakantanapasubsobkidkiranmaghilamosculturaspundidolayawracialnoonggusalinakabiladnapapadaankulisapturonpagpasokilangbuhayloveumiinitnitongbinigyanghelpstateshalikaanimmaagapanlongngunitmemorygoingnakikini-kinitatiktok,napakamotbabasahinmakapangyarihankwenta-kwentakonsultasyonnakatunghaysumusulatnangyarinagbantaysumusunostorymusicalesbuwenasnearkommunikererlaruinumikotdiyanperpektingkindergartentagpiangkassingulangfollowinguwakmakakakakayanansakop3hrslunesnapakonaaliskaninasinungalingwifinamailmentsmaka-alissaan-saannag-uwiofficeumiilingseekwaitmakapilingpasangcebupyestainilingtakedancekongaffectreleasedrecentbrasodiscouragedtaasipinatawagsteernagdabognangagsipagkantahannagpapaigibnakapagreklamonakapamintanamakapanglamangdisenyongpagkabuhaypatutunguhankikitamaagamahinangisasabadnagreklamotatayomanilbihandesisyonansalbahengpagtatanimstagegotlcdclearapelyidobasketbolnaliligohapontumamabintanamakalingtsismosanagbibigayanpinatiracarlodialledimbesincrediblekontramassachusettssampungatensyongnababalotbunutanpauwinasasakupantrabahobinentahanpsssnicoteachermatigasfuelpopularizeeducativasbinilhanjanecupidmoodbagyonunnakakalasingfonopangulosinongrichusingsetsincludeeachhinanapbabesdresspuwedengpagkakataonnalagpasanmagagandaberkeleymasasamang-loobreahbaryofuncionarisulatmangevisualcameranaglabaumuwialas-trescosechar,dahiltatlongsigla