Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

32 sentences found for "day"

1. "Every dog has its day."

2. A couple of cups of coffee in the morning help me start my day.

3. Ano ang ginugunita sa Thanksgiving Day?

4. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

5. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

6. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

7. Guten Tag! - Good day!

8. Happy birthday to my best friend, I hope you have a wonderful day!

9. He does not play video games all day.

10. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

11. Hendes smil kan lyse op en hel dag. (Her smile can light up an entire day.)

12. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

13. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

14. I have been jogging every day for a week.

15. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

16. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

17. I took the day off from work to relax on my birthday.

18. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

19. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

20. Many people start their day with a cup of coffee to help them wake up and feel more alert.

21. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

22. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

23. Schönen Tag noch! - Have a nice day!

24. She has been baking cookies all day.

25. She has been exercising every day for a month.

26. She has been working in the garden all day.

27. She surprised me with a cake on my last day of work to bid me farewell.

28. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

29. The tree provides shade on a hot day.

30. The wedding photographer captures important moments and memories from the wedding day.

31. They have been cleaning up the beach for a day.

32. They walk to the park every day.

Random Sentences

1. Reden ist Silber, Schweigen ist Gold.

2. He has been practicing basketball for hours.

3. Naglakad ang mga sundalo sa kalsada nang limahan.

4. I am absolutely thrilled about my upcoming vacation.

5. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

6. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

7. Gusto mong mapansin sa trabaho? Kung gayon, ipakita mo ang iyong husay at sipag.

8. Pakilagay mo nga ang bulaklak sa mesa.

9. I know I should have apologized sooner, but better late than never, right?

10. Nagtaka ito sa pagbabagong-anyo ni Kiko hanggang maging maliit na hayop na animo'y bayawak.

11. Sumagot agad si Kuya isang ring pa lang.

12. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

13. Det har ændret måden, vi interagerer med hinanden og øget vores evne til at dele og få adgang til information

14. Hindi ko malilimutan ang pagkanta namin ng "Hindi Kita Malilimutan" ng Bukas Palad sa aking graduation.

15. Kailan ipinanganak si Ligaya?

16. Gusto ko sana na malaman mo na pwede ba kitang mahalin?

17. Itinaas niya ang tirante ng kamiseta.

18. Pumila sa cashier ang mga mamimili nang limahan.

19. Akin na kamay mo.

20. Isang araw, umuwing mainit ang ulo ng binatilyong apo dahil natalo sa sugal.

21. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

22. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

23. Ayaw ko magtangkang magbiyahe nang walang mapa.

24. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

25. Gusto mong mapabuti ang iyong kasanayan? Kung gayon, magpraktis ka araw-araw.

26. Mabait sina Lito at kapatid niya.

27. Taos puso silang humingi ng tawad.

28. Nasa harap ng bangko ang bus stop.

29. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

30. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

31. Después de lavar la ropa, la puse a secar al sol.

32. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

33. Offering forgiveness doesn't mean we have to continue a relationship with someone who has repeatedly hurt us; setting boundaries is important for self-care.

34. May bukas ang ganito.

35. Siya ang pangunahing lider ng Katipunan sa Cavite.

36. Maganda ang website na ginawa ni Michael.

37. Binulabog ng malakas na tunog ang katahimikan ng paligid.

38. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

39. We have already paid the rent.

40. At være transkønnet kan være en svær og udfordrende rejse, da det kræver en dyb forståelse af ens identitet og en følelse af mod og autenticitet.

41. I've been taking care of my health, and so far so good.

42. Sa bahay ni Pina ang salu-salo.

43. Ang mga mata niyang banlag ay animo'y laging gulat.

44. Les étudiants doivent respecter les règles de conduite à l'école.

45. Gusto nilang sumakay ng dyipni sa Pilipinas.

46. Di Indonesia, pemerintah mendorong pembinaan nilai-nilai keagamaan yang inklusif dan menggalakkan semangat gotong royong berbasis agama.

47. Nakikihukay siya ng mga halamang ugat at namumulot ng tirang pagkain.

48.

49. Foreclosed properties may have back taxes or other outstanding debts, which the buyer may be responsible for paying.

50. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

Similar Words

birthdayPa-dayagonalSaturdayWednesdayFridaynandayaTodayworkdaydays

Recent Searches

dayanimespecializadasnabigyansinakopmaintindihantugonkarapatanminamahalnegro-slavessabadongnagbiyayainspirasyonmagasawangmagpagalingnakaririmarimopgaver,tinahakibinaonbabayarankausapinmanilbihanstorylumakasnakakamithurtigeremagtagocorporationpampagandahuertonatigilannilayuanjolibeenagyayangnagdalalumipadipinangangaknabiglakastiladibisyonnanamanibigkadaratingcentermariehumpaytinanggap1929ipatuloynagdarasalkikobinatangzoohousenearedigeringhmmmmmaximizingsumusunoearnipanliniskerbumingitbinyagangmalapadasimusapinyalutoetodaigdigguiltyapollokasinggandastonehampalabuy-laboycadenamentalpang-isahanglulusogyamanideyamadungisreadingpatakbopaghaliksinongpagpapaalaalareservationpatonggratificante,ipagtimplaantibioticsfredbehindeffektivtpangnangbabadosfindmovingtatawagpackagingshouldmakesmallssambitimprovedgotgraduallywhyonlygiyerawhileintelligencebakitthirdsyncablereturnedlibroipinalutotipkaraokenatinagmagdamagandoble-karacongresssilaindustrykakayurinasakulturlendnag-iisaimportantekatiedatapuwaumiiyakwouldpinsannag-away-awayhapag-kainanyakapyayavariedadyeyincreasedmarielpilitosakabinawiansumamagympamamahingavaledictorianerrors,bilihinbalangtumingalachartsisinamaasopanaypinanoodsagutinoftenpresenceclockmakapaniwalanyomukhangteacherpinakabatangsinaliksikmaruruminakatindigartistpahiramnaiilangnaglulutomateryalesdyipninakasakitanipinagsanglaanparehongasiaticgamebagkusbibilhinipinambilisementomalawakmanonoodkutsaritangtransportadvertisingretirarnangingilid