Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

32 sentences found for "day"

1. "Every dog has its day."

2. A couple of cups of coffee in the morning help me start my day.

3. Ano ang ginugunita sa Thanksgiving Day?

4. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

5. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

6. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

7. Guten Tag! - Good day!

8. Happy birthday to my best friend, I hope you have a wonderful day!

9. He does not play video games all day.

10. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

11. Hendes smil kan lyse op en hel dag. (Her smile can light up an entire day.)

12. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

13. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

14. I have been jogging every day for a week.

15. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

16. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

17. I took the day off from work to relax on my birthday.

18. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

19. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

20. Many people start their day with a cup of coffee to help them wake up and feel more alert.

21. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

22. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

23. Schönen Tag noch! - Have a nice day!

24. She has been baking cookies all day.

25. She has been exercising every day for a month.

26. She has been working in the garden all day.

27. She surprised me with a cake on my last day of work to bid me farewell.

28. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

29. The tree provides shade on a hot day.

30. The wedding photographer captures important moments and memories from the wedding day.

31. They have been cleaning up the beach for a day.

32. They walk to the park every day.

Random Sentences

1. Les encouragements et les récompenses peuvent être utilisés pour motiver les autres, mais il est important de ne pas les rendre dépendants de ces stimuli.

2. Investors can purchase shares of stocks through a broker or online trading platform.

3. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

4. Masama ho kasi ang pakiramdam ko.

5. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

6. El graffiti en la pared está llamando la atención de la policía.

7. Tara na. binuksan ko yung pinyuan tapos lumabas kami.

8. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

9. Nakuha ko ang first place sa aking competition kaya masayang-masaya ako ngayon.

10. The judicial branch, represented by the US

11. Bawat pamilya ay may magarang tarangkahan sa kanilang mga tahanan.

12. Inalala nila ang mga aral na itinuro ng misyunero tungkol kay Kristo.

13. Kung papansinin mo'y lagi ka ngang mababasag-ulo.

14. Anong oras gumigising si Cora?

15. Maputi si Kano, kaya ganito ang tawag dito sa kanilang pook.

16. Después de leer el libro, escribí una reseña en línea.

17. Naglaro sina Paul ng basketball.

18. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

19. A new flyover was built to ease the traffic congestion in the city center.

20. Hindi maganda na maging sobrang mapanghinala sa lahat ng tao dahil sa agam-agam.

21. Ang kaniyang galak ay animo'y nakakahawa, nagbibigay saya sa lahat ng nakapaligid.

22. Nagtatanim ako ng mga bulaklak sa mga paso upang magkaroon ng mga colorful na dekorasyon sa loob ng bahay.

23. The king's role is to represent his country and people, and to provide leadership and guidance.

24.

25. This house is for sale.

26. Pero pag harap ko, para akong nanigas sa kinatatayuan ko.

27. Si Lolo Pedro ay pinagpalaluan ng kanyang mga apo dahil sa kanyang mga kwento at payo.

28. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

29. La creatividad nos lleva a explorar nuevos caminos y descubrir nuevas posibilidades.

30. Emphasis can also be used to create a sense of urgency or importance.

31. A couple of songs from the 80s played on the radio.

32. The billionaire was known for his charitable donations to hospitals and schools.

33. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

34. Nakaupo ang babaeng nakasuot ng salamin.

35. Naglalagay ng bulletin board ang guro sa silid-aralan upang maipakita ang mga gawain ng mga estudyante.

36. Mabuti naman,Salamat!

37. Sa tagal at hirap na dinanas ng binata sa paghahanap sa dalaga, nagalit siya.

38. Nagdulot umano ng matinding trapiko ang biglaang pagkasira ng tulay.

39. Malapit ang pook na ito sa bundok ng Rabba.

40. Ano ang mga ginawa niya sa isla?

41. Women have diverse interests and hobbies, from sports and fitness to travel and cooking.

42. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

43. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

44. Di kalaunan, habang lumalaki ang bata, napapansin nilang ito nagiging salbahe, napakasinungaling at maramot.

45. Si Pedro ay namamanhikan na sa pamilya ni Maria upang hingin ang kanilang pahintulot na magpakasal.

46. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

47. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

48. Nagbigay ang albularyo ng anting-anting upang protektahan ang bata sa masasamang espiritu.

49. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

50. Sa kasalukuyang panahon ang bayabas, bukod sa ito ay kinakain o pagkapitas sa puno, ito rin ay ipinansasahog sa ating mga lutuin.

Similar Words

birthdayPa-dayagonalSaturdayWednesdayFridaynandayaTodayworkdaydays

Recent Searches

daykayabangansystems-diesel-runnangangaralpreskosiyammakukulaynapadpadnanalotumahimikdevelopmentmismoitlogattackdespuesuporememberpoliticsbigayrenacentistalegislationmilyongandreaganasalondali-daliyukololainihandanapatingalagayunmanjobsdulotnilapitantigresumisiddiferentesasiaticnapakabagalnagbigayantennisgoodeveningpinaglagablabsapatosalapaaplondonintroducebinabaanmarkedarkilasinapitmasikmurapaglulutoi-rechargemamalasannikanaramdamsharmainesalatpisidikyamnakakarinigsinakoplabahinmagkasakitpa-dayagonalkapataganpasanmapaikotuncheckedpinyahumanoscontrolledbabamasakitgusalinapagsilbihansiembranasaanalamidumikotmandukotkatagangpagdamikainiskassingulangkindergartennailigtassmokingmagkaparehodedication,walletlintaoverallkasuutanclientesentresugatanggayundinpagpapautangmealmagbabagsikpollutionkitpinagalitanlibertydalarespektivekaarawanmakaiponnakakatandakommunikerermaagangnakakaanimpadabogbarosanadiyantaingamaglabainaapibalanceskahirapandosunti-untingdawipinagbilingnagliliyabilanmag-iikasiyampagkaangatpanggatonghimihiyawsariwaleaderspinagkaloobanpanalanginmaipagmamalakingpaidiniresetakanluranmagisiptinungosamantalangmasasabiiikutanmasiyadomatandangnaantigbinasaprotegidoorkidyasassociationbinatanglupainpagpasokpakealamumibigbiliilocoscoughingsapotbritishtuladjenapusaninongsnapisopancitiatfagamatchingtagaytaynutspinatidmayoisugatakesdeterioratereadkamalayanthemboxipagtimpladarkcleanworkdayyouthpagpapakalatpupuntahankusineromanalosuzettehumahangosnaglakadpictureskakaroontrueejecutan