Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

32 sentences found for "day"

1. "Every dog has its day."

2. A couple of cups of coffee in the morning help me start my day.

3. Ano ang ginugunita sa Thanksgiving Day?

4. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

5. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

6. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

7. Guten Tag! - Good day!

8. Happy birthday to my best friend, I hope you have a wonderful day!

9. He does not play video games all day.

10. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

11. Hendes smil kan lyse op en hel dag. (Her smile can light up an entire day.)

12. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

13. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

14. I have been jogging every day for a week.

15. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

16. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

17. I took the day off from work to relax on my birthday.

18. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

19. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

20. Many people start their day with a cup of coffee to help them wake up and feel more alert.

21. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

22. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

23. Schönen Tag noch! - Have a nice day!

24. She has been baking cookies all day.

25. She has been exercising every day for a month.

26. She has been working in the garden all day.

27. She surprised me with a cake on my last day of work to bid me farewell.

28. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

29. The tree provides shade on a hot day.

30. The wedding photographer captures important moments and memories from the wedding day.

31. They have been cleaning up the beach for a day.

32. They walk to the park every day.

Random Sentences

1. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

2. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

3. Ang kalayaan ay nangangailangan ng responsibilidad at disiplina.

4. Omelettes are a popular choice for those following a low-carb or high-protein diet.

5. The police were trying to determine the culprit behind the burglary.

6. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

7. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

8. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong mayroong mga pangarap at mga layunin sa buhay.

9. Sambal adalah saus pedas yang terbuat dari cabai dan bumbu-bumbu lainnya.

10. Oh! What a coincidence, dito ka pala nagtatrabaho?

11. Nasa likuran lamang niya ang nagsalita.

12. La labradora de mi sobrina es muy amigable y siempre quiere jugar con otros perros.

13. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

14. La habilidad de Da Vinci para dibujar con gran detalle y realismo es impresionante.

15. ¡Muchas gracias!

16. Pinangaralan nila si Tony kung gaano kahalaga ang isang ama

17. Les patients peuvent avoir besoin de soins psychologiques pendant leur hospitalisation.

18. Kahapon, nakita ko siyang tulala sa parke nang walang pakialam sa mga taong nasa paligid niya.

19. Unti-unting nakakabangon ang ekonomiya ng Pilipinas matapos tanggalin ang lockdown.

20. Anong oras nagbabasa si Katie?

21. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, datapapwat ay masakit ang mawalan ng pagkakataon.

22. Tumagal ng tatlong oras ang kanyang operasyon.

23. Natutunan ko ang mga awiting Bukas Palad mula sa aking mga magulang na parehong Katoliko.

24. Ikinagagalak kong makita ang pag-unlad mo sa buhay.

25. Ein Bild sagt mehr als tausend Worte.

26. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

27. Ang mga kundiman ay nagpapahayag ng kahalagahan ng pag-ibig at pagmamahal sa ating bayan.

28. Kaya't pinabayaan na lang niya ang kanyang anak.

29. Gustong pumunta ng anak sa Davao.

30. The wedding ceremony is often followed by a honeymoon.

31. Memberikan dan melakukan tindakan baik kepada orang lain dapat meningkatkan kebahagiaan kita.

32. Nagpaabot ako ng bulaklak sa kanyang bahay upang ipakita ang aking pagmamahal sa nililigawan ko.

33. Ano ang pangalan ng doktor mo?

34. Isang umaga habang siya ay naglalakad patungo sa kanilang hardin ay may nakasalubong niya ang isang binata.

35. Arbejdsgivere leder ofte efter erfarne medarbejdere.

36. The Great Wall of China is an impressive wonder of engineering and history.

37. Ang daming pulubi sa maynila.

38. Ang mapa ng mundo ay nagpapakita ng lahat ng mga bansa sa buong mundo.

39. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

40. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

41. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

42. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

43. Ang dedikasyon ni Carlos Yulo sa kanyang isport ay nagdala sa kanya ng tagumpay sa pandaigdigang entablado.

44. Hinahabol ko ang aking hiningang mahina dahil sa kalagitnaan ng marathon.

45. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

46. Las escuelas tienen una política de tolerancia cero para el acoso escolar.

47.

48. Pagdukwang niya ay tuloy-tuloy siyang nahulog sa ilog.

49. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

50. Sino ang maghahatid sa akin sa pier?

Similar Words

birthdayPa-dayagonalSaturdayWednesdayFridaynandayaTodayworkdaydays

Recent Searches

dayumiinitmatapobrengnahahalinhanprovidemagpakasalmananaloisinalaysaynagkakakaininakalaadditionally,sasagutinnagtuturoitinulosclockumabothabangtrackmaghihintaypauwikahonitinaasbusiness,fitremainpeppyisamadiyosinitletnangyaringhulingbroadcasttoolcontinuedcassandrakawili-wilinag-umpisakalagayanmakaratingmakaraanpitotinahakbiologiluluwasdosmayabonglugargenerationsdamdaminpalancarailwaysnahulaanelectoralisinaboypakibigyankontratayourself,osakajobsgayunmanrepublicanfriendsalaminsisterkuwentohinilailalagaypoliticsdiliginbyggetseekpneumoniakalaunankinatatalungkuanggoodeveningnapaluhamakikitanaalislistahanlandlinee-commerce,dailykongresobinatakintroducepinakamaartengcurtainssandaliydelseryonideatakotaudio-visuallyvitaminmagkasinggandatagalkumikilosconectanbugtonglockdowncommercialrecentsystematiskplatformattackmisusedsinagotgitnaproblemabasahinlackpinabayaankapangyarihannakitamalambingmassesmalumbaytendercomputerprimerosnagpasankasalananprimerasmasdanbayaningpag-aaralangmagagawanangangaralcoaching:libertymagtataashmmmmricaromanticismoamerikatiyakmusicalesmaalwangheynewslagunamarchantnakakaanimginawangforskel,asiaticpaanannaiinitanpagkaraanandreacarolheikatedralpitakaproducts:diferentesmakuhangpatakaskargahankalongonlynangingisayika-12inventionikinabubuhaybinabaanmahuhulipupuntahamakgrowthmovieedsamag-iikasiyamayusincompostelamakakatakasmakatatlopersistent,shouldxviisharerestawanlupainmanalopinaoperahankindlepumikitrightssagabalmwuaaahhkiniligstyrernagpapaitimmakakatalogayundinlumibotextremistpowerpost