Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "sikip"

1. Kay sikip na ng daraanan ay patakbo ka pa kung lumabas!

Random Sentences

1. It's important to provide proper nutrition and health care to pets.

2. Mahalaga ang papel ng edukasyon sa pagpapalawig ng kaalaman at oportunidad para sa sektor ng anak-pawis.

3. Tinignan nya ilan sa mga ginawa ko, Okay na yan.

4. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

5. Emphasis is the act of placing greater importance or focus on something.

6. Ang bata ay na-suway sa kanyang magulang nang hindi sumunod sa kautusan.

7. Sa kanyang propesyonal na larangan, itinuturing siyang eksperto dahil sa kanyang natatanging abilidad.

8. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

9. Las labradoras son muy leales y pueden ser grandes compañeros de vida.

10. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

11. En algunos países, el Día de San Valentín se celebra como el Día del Amigo.

12. Sa aking hardin, ako ay nagtatanim ng mga bulaklak.

13. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

14. Alas-diyes kinse na ng umaga.

15. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

16. Television is a medium that has become a staple in most households around the world

17. Salatin mo ang mga butones ng remote upang mahanap ang tamang pindutan.

18. Sa ganang iyo, bakit hindi lahat ng tao ay pantay-pantay ang oportunidad sa buhay?

19. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

20. Quiero ser una influencia positiva en la vida de las personas que me rodean. (I want to be a positive influence in the lives of people around me.)

21. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

22. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

23. Es importante evitar rascarse o manipular las heridas para facilitar su cicatrización.

24. Danmark eksporterer også en betydelig mængde medicinske produkter.

25. Pakanta-kanta si Maria habang nagtatrabaho.

26. Claro que puedo acompañarte al concierto, me encantaría.

27. En invierno, se pueden ver hermosos paisajes cubiertos de nieve y montañas nevadas.

28. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

29. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

30. Einstein's brain was preserved for scientific study after his death in 1955.

31. Na parang may tumulak.

32. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

33. La música es una parte importante de la educación musical y artística.

34. The children are not playing outside.

35. Bukas ay magpapabunot na ako ng ngipin.

36. Eh? Anlabo? Hindi mo naman kaboses yun eh.

37. Omelettes are a popular choice for those following a low-carb or high-protein diet.

38. Gusto ko ang pansit na niluto mo.

39. Malayo ho ba ang estasyon ng tren?

40. Durante las vacaciones, nos reunimos alrededor de la mesa para compartir historias y risas con la familia.

41. Guten Abend! - Good evening!

42. May limang estudyante sa klasrum.

43. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

44. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

45. Ang aming washing machine ay madalas magamit dahil halos araw-araw kaming naglalaba.

46. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

47. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

48. Il fait beau aujourd'hui, n'est-ce pas?

49. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

50. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

Recent Searches

gulangkaragatanbutosikipmisteryopalapagcalidadipagmalaakimerchandiseevolvewriting,bintanahulupantalongbahagyanagyayanginilabasbangkangpinalalayaskaliwakasamaangpinauwikagubatankapintasangnatatawaganitoinfluencessisidlanganidsumisidtugonpinalayasestilosyorkkasamabilanginhanginsalesalakkailankendinoonmatulissalatkamustamabutitokyoorganizesilyakasaysayanknightnasanimagesnatulogpusainalagaannakinigdogbrasonahuluganilanpollutionmagnagbabasaincreaseyakapingoalgrinssemillaskalakingvehicleskumatokplasailawmagkasinggandahopeinulitmejoedsakelanmeronpalangmagdaitongstaplecryptocurrency:barnesginangtakescupidtainganooradiopiecespinyageneingatannegosyopaslitfeelingetofuncionarioselectroniccigarettesumapitposterbigfloorbuskingconventionalgraceipinalutopilingmalakingmainstreamwouldgenerationssamaamingupworkresttomdingginorderdossafenapabalikwashumihinginaglabanagsusulatseticonscomplexincludelearningsequeclassesamazoniginitgitexplainmediumtwomessagedependingmagagamitcornersnakabilimawalaayospatutunguhanmag-isapebrerocardiganmuntikanmasaganangtaxipalayointensidadmaximizingiintayinilogmatadaratingbasacarbonjenareadlegendarytatlonghaftharddaminghiwadiretsahangplaguednahuhumalinghesusmasilipcoachingdejatiniklingfollowingnatatanawpadalasmangingisdangtandanggagamitawitanpasahenaghubadtsonggowalkie-talkiemagkahawakbaku-bakongpinakamaartengnasasakupanpare-parehoanibersaryo