Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "dollar"

1. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

Random Sentences

1. He was hospitalized for pneumonia and was on a ventilator for several days.

2. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

3. Adopting a pet from a shelter can provide a loving home for an animal in need.

4. Hindi ko kaya itago ang aking damdamin, kaya sana pwede ba kita ligawan?

5. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

6. They have been renovating their house for months.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. Sa ganang iyo, sapat ba ang paghingi niya ng tawad upang mapatawad ng lahat?

9. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

10. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

11. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

12. Jeg har fået meget værdifuld erfaring gennem min karriere.

13. Binabasa niya ng pahapyaw ng kabuuan ng seleksyon at nilalaktawan ang hindi kawili-wili

14. The new factory was built with the acquired assets.

15. I caught my boyfriend staring at a picture of a pretty lady on his phone.

16. The early bird catches the worm.

17. Bumili ka ng blusa sa Liberty Mall.

18. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

19. Einstein was married twice and had three children.

20.

21. The bookshelf was filled with hefty tomes on a wide range of subjects.

22. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

23. Limitations can be addressed through education, advocacy, and policy changes.

24. The stock market gained momentum after the announcement of the new product.

25. Las hojas de otoño son muy bonitas en la ciudad.

26. Ang tubig ay kailangan ng tao para mabuhay.

27. Acts of kindness, no matter how small, contribute to a more charitable world.

28. Børn skal have mulighed for at udforske og lære om verden omkring dem.

29. La tos seca es una tos que no produce esputo o flema.

30. Ang pagiging makapamilya ay isa sa pinakamagandang katangian ng mga Pinoy.

31. Ang Ibong Adarna ay may mahabang kwento na puno ng kaguluhan at kababalaghan.

32. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

33. Good things come to those who wait.

34. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

35. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

36. Nakikini-kinita niya ang paghugos ng mga mangingisda.

37. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

38. Hindi tayo sigurado/nakatitiyak.

39. Ang guro ko sa agham ay mahusay sa pagpapaliwanag ng mga konsepto.

40. En invierno, se encienden chimeneas y estufas para mantener el calor en las casas.

41. Pakilagay mo nga ang bulaklak sa mesa.

42. Napatunayan nilang lason ang mga bunga nang isang araw ay may napadpad na manlalakbay sa kanilang bayan.

43. Nakuha ko ang first place sa aking competition kaya masayang-masaya ako ngayon.

44. Nagbabakasyon ako sa beach kasama ang pamilya kaya masayang-masaya ako ngayon.

45. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

46. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

47. Sa palaruan, maraming bata ang nag-aagawan sa isang bola.

48. Mas maganda ang photoshoot sa dapit-hapon dahil ang ilaw ay nakakapagbigay ng ibang vibe.

49. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

50. Has he spoken with the client yet?

Recent Searches

beeneducationalfatalcalldollareksaytedmapadaliteamdumatingfistsspeedtuwidtwinklestatusstudentcomeshockkumarimotbelievedtransitbilisdontitinalicompartenmalinisrobotictennagreplylatestpinalutobilhinspecialcommissioncomienzanveryredesleukemiahinabanilinislegendsharingshiftcomputercomplexincludegitarahateneedsbehaviorwindowformsflashcompleteexplainberkeleytwopublishedcableipinalutoviewbasaelectedstopknowmenucommercegoingextraprovidedinteriorthoughtsonlytiyasquatteritlogdoscomputereflyactiondoonnothingcleancakeipapahingahimutokpagdespuesnagdaramdamhumihingimonghumarapadvertising,baoendviderenagsisilbikagalakanmallopdeltpagtiisanmagdamanueltungawmaaringlasingcigarettesakongsalitangmulti-billionbironakakapagpatibayrecordedreadpshpartnerkunwasuottoreteheartbeatkendiumagangmartiannilaostuktokfrancisconatabunanevolucionadoattentionkinamumuhiannamangpowerpointingaytarangkahantumigilnatatawatumitigilnagbibironagbabalainspirasyonallergynagsagawamag-iikasiyamalamnangampanyabuwisnagpapasasajunionalugmokpagkatakotkaano-anoatensyongkahariannapanoodnakuhanapakabaitumiinommagkamaligumagamitnapagtantonarinigmorningmahuhusaykalaunanpagpanhikcourtskirtinuulamnaghilamospanalangininvestmagpapigilculturasmadungiskadalasinterests,mamahalinberegningernakapasoktumutubonakayukosiniyasatinaabutanpaglisanmagsi-skiingmagbabagsikpanghihiyangpagkabuhaynakasandignagkapilattig-bebeintesignallazadaoktubrealitaptapnagagandahannapaplastikannakapangasawawalkie-talkienagtutulunganmagpa-ospitalagwador