Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "communications"

1. One of the most significant areas of technological advancement in recent years has been in the field of communications

Random Sentences

1. Les employeurs peuvent promouvoir la diversité et l'inclusion sur le lieu de travail pour créer un environnement de travail équitable pour tous.

2. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

3. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

4. Mi vecino tiene una labradora dorada que siempre corre a saludarme.

5. Las serpientes son carnívoras y se alimentan principalmente de roedores, aves y otros reptiles.

6. Nag-aral ng kasaysayan ang estudyante.

7. Umalis siya sa klase nang maaga.

8. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

9. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

10. Mas maliit ang bag ko sa bag ni Cassandra.

11. Unti-unting gumuhit ang ngiti sa mga labi niya.

12. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

13. Dumating siya mula sa Bikol kahapon ng umaga.

14. Taman Safari Indonesia di Bogor adalah tempat wisata yang menampilkan satwa liar dari berbagai belahan dunia.

15. Masyadong maluwang ang pantalon na ito.

16. Les salles d'hôpital sont souvent partagées entre plusieurs patients.

17. Sa pagtatapos ng araw, nakakapagbigay ng kakaibang kalma ang pakikinig sa musika habang nag-iisa.

18. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

19. Madami ka makikita sa youtube.

20. Parang gusto ko nang magka-baby. pagkuwan eh sabi niya.

21. Napatulala ako sa kanya. Di ko alam ang isasagot ko.

22. The pretty lady in the movie stole the protagonist's heart.

23. ¿Qué edad tienes?

24. Gusto naming makita uli si Baby Janna eh. si Maico.

25. En invierno, la contaminación del aire puede ser un problema debido a la calefacción en interiores y a la menor circulación del aire exterior.

26. Natuto akong magluto ng masarap na pagkain kaya masayang-masaya ako ngayon.

27. Wala na naman kami internet!

28. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

29. "Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan" ay isang bukambibig na nagpapaalala na mahalaga ang pag-alala at pagpahalaga sa mga pinagmulan.

30. Sige, tatawag na lang ako mamaya pag pauwi na ko..

31. Maging ang mga diyosa ay kanyang hinamak na wala na ngang makahihigit pa sa galing niya.

32. Sige na, sabihin mo na yung mga gusto mong sabihin sa akin.

33. Hindi natin dapat husgahan ang mga tao base sa kanilang kababawan dahil maaaring mayroon silang malalim na dahilan.

34. Hinanap niya si Pinang.

35. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng positibong pananaw at pagpapakita ng determinasyon.

36. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

37. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

38. En el siglo XVII, el Barroco español produjo figuras importantes como Francisco Guerrero y Tomás Luis de Victoria

39. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

40. Los héroes inspiran a otros a levantarse y luchar por lo que es correcto.

41. Les personnes âgées peuvent avoir des relations intergénérationnelles enrichissantes avec leurs petits-enfants.

42. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

43. Después de estudiar el examen, estoy segura de que lo haré bien.

44. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

45. A lot of rain caused flooding in the streets.

46. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

47. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

48. Isang mahahalagang pag-uusap o tagpo ang naganap sa loob ng kabanata, na nagbibigay ng bagong pag-unawa sa mga karakter.

49. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

50. Bawat eskwelahan ay may kanya kanyang alituntunin.

Recent Searches

forcesdevelopedpootngpuntalaterfloorcommunicationsdemocraticcompartenmajorpshalambusyangkwebangisugaagahallritobroadcastnicecontentpeterbeforeprovidedupworkcornernariningformmuchstatearmedactiontruedoesaddeksamferrerviewsidea:joynaroonplatformsjunjunvisualdecreaseyeahsystembehaviorpatrickintelligencemessagedifferentamountmonitorexplaindedicationstopcablepilingeithertechnologicalanotherbasanagpupuntanakukuhasenatebutterflyhubad-baroagwadorngunitpinag-usapanaumentaramintilasiopaoiglapnangingisaybuhokmaatimphilippineayawkumaripastanghalianglobalmulbayaniimportantesrepresentativesinantokmataliktanimoliviaanyokasamaangnaggalaendviderepeacebatalanfrescopagkaphysicalexpectationsagostosimplengstuffedkinikitanagpapaypayhinandencolorkumirotbilibidnungnamuhaynagbibiroreguleringltobibigyaninfinitypapaanotheypalibhasamainstreamworldmadeinteriormarchpakealamhalikanpancitpinagawaaleberkeleyvirksomhederoktubrekapainsittingstudiedkampeonlucasmagpapakabaitnakikini-kinitamakapangyarihanpilipinasinsteadsikmuranakumbinsitinaasaniikotmatiyakatensyonmuntingmag-asawanatanggapskyldes,bulahumihingalsearchmagselosmaintindihanguidelongsumusulatmagturosumarapperyahanasahankaratulangpramisnaritongangequipomamahalinmesangintramurosbossmacadamiaalas-dosealingfreeincluirpangalanpisarajolibeetuladpinasalamatansobrangyamanhdtvnagdarasalinangdaratingagilasamantalangnamofficeexperiencesrelativelybaguiotagakdialled