Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "late"

1. Basketball is a team sport that originated in the United States in the late 1800s.

2. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

3. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

4. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

5. I finally finished my degree at age 40 - better late than never!

6. I finally quit smoking after 30 years - better late than never.

7. I forgot your birthday, but here's a card anyway. Better late than never, right?

8. I just got around to watching that movie - better late than never.

9. I know I should have apologized sooner, but better late than never, right?

10. I know I should have gone to the dentist sooner, but better late than never.

11. I know I should have started studying earlier, but better late than never, right?

12. I know I'm late, but better late than never, right?

13. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

14. Late ako kasi nasira ang kotse ko.

15. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

16. Maaf, saya terlambat. - Sorry, I'm late.

17. Más vale tarde que nunca. - Better late than never.

18. She has a poor credit history due to late payments and defaults on loans.

19. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

20. The phone rang late at night, and therefore she was hesitant to answer it.

21. We didn't start saving for retirement until our 40s, but better late than never.

22. We should have painted the house last year, but better late than never.

Random Sentences

1. Hindi pa nga ako nagtatanghalian eh.

2. Pakibigay ng malakas na palakpak ang lahat para sa ating mga guro.

3. Tinawag nilang ranay ang insekto na katagalan ay naging anay.

4. Ngunit kailangang lumakad na siya.

5. Padabog akong umupo habang dumadating na yung order nya.

6. Kung wala kang pera umalis ka na dyan at baka hindi ako makapagpigil sa iyo.

7. Kailangan nating magplano upang mas mapadali ang pag-abot ng ating mga pangarap.

8. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

9. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

10. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

11. Lumapit siya sa akin at sumandal sa may sink.

12. What goes around, comes around.

13. Nakasandig ang ulo sa tagpiang dingding.

14. Napakahusay na doktor ni Jose Rizal.

15. Samantala sa bahay, nagluluto siya ng paboritong putahe ng kanyang asawa.

16. Ang daddy ko ay masipag.

17. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

18. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

19. Weddings are typically celebrated with family and friends.

20. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

21. En invierno, se encienden chimeneas y estufas para mantener el calor en las casas.

22. Les personnes âgées peuvent avoir des relations affectives et intimes avec leur partenaire.

23. Ano ang pangalan ng doktor mo?

24. Ang Linggo ng Pagkabuhay ay pagdiriwang.

25. He does not watch television.

26. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

27. Paki-drawing mo naman ako ng isang magandang larawan.

28. The culprit who stole the purse was caught on camera and identified by the victim.

29. Mabuti pa nga Babe, bugbugin mo na yan. pagbibiro nila.

30. Puwedeng gamitin ang pagguhit upang mag-drawing ng mga bagay na gusto mong ma-achieve sa buhay.

31. Ikinagagalak kong maglingkod sa inyo bilang inyong guro.

32. Si Dr. John ay isang doktor sa kanilang baryo.

33. Saan nagtapos ng kolehiyo si Peter?

34. Si Bereti ay mula sa angkan na may maalwang buhay.

35. Omelettes are a popular choice for those following a low-carb or high-protein diet.

36. El uso de drogas puede ser un síntoma de problemas subyacentes como depresión o ansiedad.

37. Maraming bansa ang nagsimula ng digmaan dahil sa territorial disputes.

38. Sumakit ang tiyan ko kagabi kaya ako ay biglaang nagka-sick leave.

39. Naiwan ko ang mga kubyertos sa bahay kaya nagdala ako ng disposable na kutsara at tinidor.

40. Bitte schön! - You're welcome!

41. Other parts of the world like Burma and Cuba also cultivated tobacco

42. The victim was able to identify the culprit who had been harassing them for months.

43. Tuwing biyernes, ginugol niya ang buong araw sa paglilinis at paglalaba ng bahay.

44.

45. Panay pa ang post nito sa facebook ng bagong damit eh hiram lang naman nya ang lahat nang yun.

46. Ano ho ba ang itsura ng gusali?

47. Satu titik hitam bisa merusak noda yang putih.

48. Kahit pagod ka na sa trabaho, nakakarelax ang paglalakad sa dapit-hapon.

49. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

50. The children are playing with their toys.

Similar Words

Paki-translatelaterbulatelatest

Recent Searches

latehonestocasaechaveimaginationenglishnatatangingteacherikinakagalitfactoreshulihankaraokekagipitanbumagsakmasaktansiraemocionesmakalaglag-pantyevneginawangtigaslegendswantbelievedsorryinspirasyonmaalwangregulering,luluwastinahaknagpakitainatakeinaabutanakongyoungkatagaawtoritadongpanghabambuhaytensalatpagluluksasocialeamerikakampanawaterestasyonbasketbolnakapagreklamoenglandkanikanilangcarmenpoongkuwadernostockstransport,produjopeoplekikitahugislibolangbataymagkabilangdistansyanamanalalaglagmaabutantanganmarioiba-ibangumupoinaabotnatitiramerryabangansinasabibatokaliwapaghalakhakgeartalagaagostonakatagocornersnagtungoochandonucleareditornagbiyahecomunicarseumigtadpapanhikpostersummermini-helicopterandoyinantaybilisangkopisinakripisyomakulonghurtigeresabadomagpagupitkanyabegannagtatakabayaningpagkakapagsalitakirotclientesignuniversitytilgangmakakatakassabermaaringwouldkuripottrenpagkakatayostapledoonnagulatissueswonderresignationnatulogtenderwidespreadltomakapalagprobinsyasinunodsilaykababaihanhmmmmemailgeneratedprogressiginitgitprogramming,aplicaciones11pmputingproblemaefficientautomatiskdesarrollaronknowledgeadditionallyikinalulungkotlupainsobracryptocurrency:workingjuanlasingbeginningsflexiblestrategiesdeletingwindowmatigaspagkabuhaymagbabagsikpsssmasasabimag-uusapalintuntuninkaminagaganapre-reviewevolvedpilatinatanongpopularizemagka-apopapasokmagbakasyonnag-iisipletternaligawnegativesana-allenforcinggupitkiloputaheumanocommunicationalakgumapangyanpaosbuung-buotaksipaki-ulitilagaynagsunuran