Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Sopas ang ipinabalik ko sa waiter.

2. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

3. Ang agila ang pambansang ibon ng Pilipinas.

4. Emphasis is the act of placing greater importance or focus on something.

5. Kailangang di niya malimutan ang araw na ito.

6. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

7. Hoy en día, el internet es una parte integral de la vida cotidiana.

8. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

9. El uso de las redes sociales está en constante aumento.

10. Kapag may mga hindi malinaw na plano sa buhay, maaaring magdulot ito ng agam-agam sa mga tao.

11. The website's online store has a great selection of products at affordable prices.

12. Ang bilis nya natapos maligo.

13. Sweetness can be used to mask other flavors and create a more palatable taste.

14. The sun is not shining today.

15. Ang mga estudyante ay bumalik na sa kanilang mga dormitoryo sa hatinggabi.

16. Endvidere er Danmark også kendt for sin høje grad af offentlig velfærd

17. Lumipad palayo ang saranggola at hindi na nila nakita.

18. Nanalo siya sa song-writing contest.

19. It is an important component of the global financial system and economy.

20. Sa kabila ng pagkamatay niya, ang diwa at mga ideya ni Jose Rizal ay nananatiling buhay at patuloy na nagbibigay-galang sa kasalukuyang henerasyon ng mga Pilipino.

21. Maraming bayani ang nag-ambag ng kanilang talino at kaalaman upang mapabuti ang kalagayan ng bayan.

22. Pagkatapos kong maglaba ay pupunta na ako sa mall.

23. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

24. El nacimiento es un evento muy emocionante y significativo en la vida de una familia.

25. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

26. Ang reception ng kasal ay nagbibigay ng pagkakataon para ipagdiwang ang bagong kasal at kumain ng masarap na pagkain.

27. Ang kanyang negosyo ay lumago nang husto, samakatuwid, nakapagbukas siya ng panibagong branch.

28. I am not listening to music right now.

29. Ilan ang batang naglalaro sa labas?

30. Terima kasih banyak! - Thank you very much!

31. Los padres pueden prepararse para el nacimiento tomando clases de parto y leyendo sobre el proceso del parto.

32. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

33. The CEO received a hefty bonus for successfully leading the company through a period of growth.

34. Hindi maganda ang resulta ng ginawang pag susulit ni Mikaela.

35. Marami ang botante sa aming lugar.

36. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

37. Ibinigay ko ang aking buong atensyon sa kanyang mga salita upang maunawaan ang kanyang mga kahilingan.

38. Ang aming pagsasama bilang magkabilang kabiyak ay puno ng pagpapahalaga at respeto sa isa't isa.

39. Siguro matutuwa na kayo niyan.

40. Napakagaling nyang mag drowing.

41. Bakit kayo nagtungo sa Mendiola?

42. Hinugot niya ang kanyang hininga bago siya sumagot sa tanong ng guro.

43. Namumuo ang pawis sa kanyang anit at sa ibabaw ng kanyang nguso.

44. Nogle helte er berømte idrætsstjerner.

45. Beber suficiente agua es esencial para una alimentación saludable.

46. Oo naman. I dont want to disappoint them.

47. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng stress at pagkalungkot.

48. O-order na ako. sabi ko sa kanya.

49. Las redes sociales permiten a las personas conectarse y compartir información con amigos y familiares.

50. Napangiti na lang ang binata at sumama sa dalaga, simula ng araw na iyon ay lagi na silang nagkikita.

Similar Words

High-definitionhighest

Recent Searches

ledhighorderdollarrepresentativebinilingcontrolanegro-slavesdulocompletemediumcontrolledactormabaitinaapisalitasetsadaptabilityawareincreaseeffectsinfinityscaleamountbetaalituntunintambayankumatokinangimagesmagigitingpamimilhingrisetamalumalangoysamahannakaramdampodcasts,kumembut-kembotpresidentialnagtrabahopaga-alalapinagpatuloynapakatalinomakakasahodnakakasamanagtatanongpagsumamomagkaibangpamilyanginferioresnakalagaynapakabisigparangginaarturoeconomicmatulunginpayapangkaraokesinaliksiknaiilanginiisiphinabolnapapikitamericantigaspamamahingapresencedinanassementokatagangmakinanglalakesumisilipdeterminasyonpusaninyonenaindividualshampaslupapinapalofe-facebooktenermataasforståmalapitanmasipagathenaofrecenmatapangayawstocksgardenknightincidencematigasyumanigmatayogaminbingipanodilimprivatetiketrenatofulfillingulouuwiistasyonpaghahabimagbibiladmagtigilbalahiboprimerossasakyanpahirammagkasamapagkagustoninanaisnapapansinlinggonginiindakontratamakauwimasyadongkamandaggawinpagkagisingnamangovernmentkisapmatananonoodpagkaawamagkanonakapagproposetumamalalabaslumutangisinusuotpaninginnagbagopagbibirosinehanmahabolnatanongbangkangcanteenpatuloysaan-saanmasagananglumagonakainomuniversityperpektingeksempelisinaboynaabotmagsabikagubatanhawakumagangnglalabaano-anosilid-aralaniyamotiligtaslumiitkalabanoperativosrespektivedescargarsumalakaypakibigyannagbibigayanaseanrimasmaligayanahantadhumiganatigilanmalasutlade-lataunconstitutionaldooneducationalsumaligrinstsinelassakimawardperwisyotamadmalinisangkannakabibingingtotoongtatanghaliinbook