Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Siempre me preocupo demasiado por las cosas, pero debería recordar que "que sera, sera."

2. Pull yourself together and stop making excuses for your behavior.

3. Uy, malapit na pala birthday mo!

4. She watched a series of documentaries about the history of ancient civilizations.

5. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

6. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

7. Hindi minabuti ni Ogor ang kanyang pagsigaw.

8. Ayos lang. Basta alam kong safe kang nakauwi.

9. Musk's companies have been recognized for their innovation and sustainability efforts.

10. Nagliliyab ang mga damdamin ng mga tao habang sila ay nagpoprotesta sa kalsada.

11. Paki-drawing mo naman ako ng isang magandang larawan.

12. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

13. Kinakailangang kahit paano'y magkaroon tayo ng maihaharap na katibayang siya nga ang dumukot ng inyong kuwarta.

14. La música puede ser utilizada para fines políticos o sociales.

15. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

16. Nahawa ako ng kuto sa kapatid ko.

17. Durante el invierno, algunos lugares experimentan nevadas y paisajes cubiertos de blanco.

18. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

19. She carefully layered the cake with alternating flavors of chocolate and vanilla.

20. Iyon ang totoo, sinasabi niya sa sarili.

21. El discurso del político está llamando la atención de los votantes.

22. Ang kanyang presensya sa aming pagtitipon ay lubos naming ikinagagalak.

23. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

24. There?s a world out there that we should see

25. Ang sugal ay naglalabas ng mga salarin na nagpapayaman sa pamamagitan ng pag-aabuso sa mga manlalaro.

26. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

27. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

28. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

29. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

30. Børn bør lære om ansvar og respekt for andre mennesker.

31. Ilan ang tiya mo na nasa Amerika?

32. Magsasalita pa sana siya nang biglang may dumating.

33. Ang sarap maligo sa dagat!

34. Ang sugal ay maaaring magdulot ng pagkakaroon ng mga utang at pinansyal na problema.

35. Andyan kana naman.

36. Ang mga hardin sa mga pribadong sityo ay ipinapalagay na mayabong at nag-aalok ng kaginhawahan.

37. The children play in the playground.

38. Sí, claro, puedo esperar unos minutos más.

39. Nagbigay ng biglaang meeting ang boss ko kanina kaya hindi ako nakapaghanda.

40. Pasensya na, kailangan ko nang umalis.

41. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

42. Mahalagang maglaan ng sapat na oras sa pag-aaral upang magtagumpay sa buhay, samakatuwid.

43. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

44. Emphasis can be used to provide clarity and direction in writing.

45. Las redes sociales son una parte importante de nuestras vidas hoy en día.

46. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

47. Sang-ayon ako sa kagustuhan mo na magpatuloy sa iyong pag-aaral.

48. Humingi siya ng makakain.

49. Lumapit sakin si Kenji tapos naka smile siya.

50. Si Mabini ay naging pangalawang pangulo ng unang Republika ng Pilipinas.

Similar Words

High-definitionhighest

Recent Searches

highdulabulapacegapcomunicarsestatingmetodisknagsusulatlinggongdejanaglalaromangyaripedenaglipanangtaga-lupanggayunmanmagkakaanakpinag-usapanpagkapasokeskuwelapagtatanongjobsnananalongtumagalnakuhanaibibigayemocionalcompaniesmagtagonailigtasactualidadkilayfatkinakainmatagumpaytsismosavedvarendekanlurannatalopaglayaspagsusulitmbricospaggawacurtainsherramientasmaghapongpangiltamisinastatodasconventionalmaskinapatingindisposalkarangalaniniinomgoodeveningtrespalayfurnilulonlettersinampalnagulatdaysdrayberboksingcryptocurrencyhoyindustrynanggigimalmalvasquesdontdamitmang-aawitintroducecigaretteslikelylayout,nakapagreklamonangangahoygobernadorpinagsulatmagkaibiganmagkakagustohigh-definitionmakakasahodpoliticalnakapangasawakaaya-ayangmanlalakbaybilinmaglalakadvideos,inteligentesnagliliyabpagka-maktolnagngangalanggratificante,pinagtagponagbabakasyonnapakabangoinisipbinatilyongtoretebilanggokinabubuhaybusynakatiraisinulatreserbasyonlumalakipinakamatabangfundrisekinagagalakpinakamatapatnakitanagmakaawapagkabuhayhinawakanmakapagsabilabing-siyamgulatnagsagawanamumulotmahawaannasasabihannananalodisenyongtig-bebentetagtuyotmensajesnakuhangpagdukwangnagpuyosnangangaralmahahanaynakaririmarimgagawinbumisitamagsi-skiingpupuntahanpagkalitobeginningnapakamotnakadapaiintayininilalabasmaliksinaglakadsakristankumidlatnagcurvenagkalapitnakaraannagmistulangtumutubopamilihannag-aagawanpaglakinakatalungkonagpakunotpinagawafitnesskahuluganibinibigayinjurygumagamitmagkamalikalaunanmahuhusayhouseholdspangyayarimakabilinapapahintohoneymoonpaki-ulitnagwagipagkainismakukulaytemparaturanaliwanaganpangungusapinaaminmakakabalikumakbaywatawatsasakyanninanaistinawagnami-misspasyamaipapautangmagkasamalandlinehulunagagamitnakataaskongreso