Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang paggamit ng droga ay hindi lamang nakakasira ng kalusugan ng isang tao, kundi maaari rin itong magdulot ng epekto sa buong lipunan.

2. Der frühe Vogel fängt den Wurm.

3. Wer nicht wagt, der nicht gewinnt.

4. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

5. "Ang taong nagiging bato sa huli, dapat alisin ang sariling uka" ay isang bukambibig na nagpapahiwatig na ang mga taong nagiging matigas ang loob o nagbubulag-bulagan sa mga sitwasyon ay dapat magbago.

6. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

7. The scientist conducted a series of experiments to test her hypothesis.

8. If you think I'm the one who broke the vase, you're barking up the wrong tree.

9. Inakalang imposible ang kanyang pangarap, pero naabot niya ito.

10. Sa hirap ng sitwasyon, nangahas siyang humingi ng tulong mula sa mga estranghero.

11. El lienzo es la superficie más común utilizada para la pintura.

12. Natuto siyang lumaban sa kaniyang mga magulang.

13. Claro que sí, estoy dispuesto a aprender cosas nuevas.

14. Many schools and universities now use television as a way to provide distance learning

15. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

16. Ipaliwanag ang mga sumusunod na salita.

17. Kitang-kita sa muka ng ina ang pagtataka dahil may dalang basket na puno ng mga gulay at prutas.

18. Ginagamit ang "tila" upang ipakita ang pagkakahawig o pagsasalarawan ng isang bagay, sitwasyon, o damdamin na hindi ganap na tiyak ngunit may pagkakahawig sa isang bagay o pangyayari.

19. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

20. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

21. Ese comportamiento está llamando la atención.

22. Ilan ang tiya mo na nasa Amerika?

23. S-sorry. nasabi ko maya-maya.

24. Nag-aabang sa langit, sa mga ulap, sumisilip

25. Les jeux peuvent également dépendre de la chance, de la compétence ou d'une combinaison des deux.

26. Oh bakit nandito ka pa? ani Maico bilang tugon.

27.

28. Übung macht den Meister.

29. Mahalaga ang pagkakaroon ng kalayaan sa edukasyon upang mapalawak ang ating kaalaman at pag-iisip.

30. Tumatawa pa siya saka pumikit ulit.

31. Mula sa malayo, anong gulat nila Magda nang makitang nagtalunan sa ilog sina Maria at Jose upang humabol.

32. Ignorieren wir unser Gewissen, kann dies zu einem schlechten Gewissen und Schuldgefühlen führen.

33. Punta tayo sa park.

34. Sa aling bahagi ng pelikula ka natawa?

35. Agradezco profundamente tu dedicación y esfuerzo.

36. Scissors are an essential tool in classrooms for art projects and cutting paper.

37. Ang bango ng kape sa umaga ay nagbibigay ng mabuting simula sa araw.

38. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

39. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

40. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

41. Kukuha lang ako ng first aid kit para jan sa sugat mo.

42. Hinawakan niya ito sa isang bisig at sa pagdidilim ng kanyang paningin ay pabalingat niyang pinipilit sa likod.

43. Si Josefa ay maraming alagang pusa.

44. Nagpamasahe siya sa Island Spa.

45. The game is played with two teams of five players each.

46. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

47. Di mana bumi dipijak, di situ langit dijunjung.

48. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

49. Kaya lumaki si Pinang sa layaw.

50. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

Similar Words

High-definitionhighest

Recent Searches

highnakakapagpatibaypinakamahalagangbagkus,pagkakatayopinapakiramdamanmatalinomagtatagalmag-usapnakabulagtangkadalagahangnapakatagalnakapagreklamokalakihansasayawinmaihaharapnahawakankikitamahiwagangpinapasayabinibiyayaanpinakabatangpalabuy-laboynaupokarwahengpamahalaantaun-taoninakalangmakatarungangpambahayiintayinbabasahinsharmaineibiniliencuestasmagkaharapnalugmoknahihiyangflyvemaskinerpagmamanehohandaantinayaplicacionespangungusapnaliwanagansumusulattinawaghayaangpagkaraakayabanganpahirammaisusuotpinapatapospinaulananpinangaralandescargarcruzmahuhulikaramihanpakakasalannaliligopamanmataassuwailpanunuksodalawangunconventionalpaketepatientsurveystrenoperahansignumalisdeletingabanganmagpapaligoyligoymatabangpuwedetwo-partysumasambalegislativeflexiblegivedeterioratepalagibatosukatpossibleaksiyonnakakitaeconomicusuariotraffictirahanformatinaapicommercepopulationbabastrategycomunestooo-onlinemakingkinumutankaninumanmanlalakbaylumakasyumabonggumagalaw-galawnanunuriintensidadpagsagotnagpalutosinusuklalyanpamumunoincluirkaraokebulalasnaiinisnglalabaumiyakmagagamitpumayaghahaha1970sinstrumentalnaguusapsinonationalalagangtienenkungnanaogbenefitstelephoneumaagospakibigyanhinugotbefolkningenlolahabitsnabanggabesideskuboeffectskundimanibabawtusongundeniablepangalananfreedomsescuelasadvertisingnangingitngithelenamandirigmangvegasbihasamoneytibokkainanshadeshumigaangkopahhhhiniintaycnicokakayanangbulongdomingoaddictionalaspaki-basaexpectationsseniormatarayiskedyullipadcharismaticlilysitawhundrediyanpogitarcilaplasasusulitkinaindemocracycasaredigeringkasoipantalopkasingtigasreboundmaluwangmrssakin