Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Hun er en fascinerende dame. (She is a fascinating lady.)

2. The decision to release the product early was a risky but ultimately successful strategy.

3. Ano ang natanggap ni Tonette?

4. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

5. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

6. Salamat na lang.

7. Dahil sa kagustuhang malaman ng mga kapatid ni Psyche ang hitsura ng asawa, tinanggal nila ang maskara nito at tumambad ang magandang mukha ni Cupid

8. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

9. Sepandai-pandainya tupai melompat, akhirnya jatuh juga.

10. Sweetness can be balanced with other flavors to create a harmonious taste experience.

11. Proper training and socialization are essential for a well-behaved dog.

12. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

13. Nakaupo ako nang matagal sa sinehan.

14. Mi amigo del colegio se convirtió en un abogado exitoso.

15. Huwag po, maawa po kayo sa akin

16. Miguel Ángel dejó muchas obras inacabadas, incluyendo su proyecto para la tumba de Julio II.

17. Sino ang susundo sa amin sa airport?

18. Winning the championship left the team feeling euphoric.

19. I know I should have apologized sooner, but better late than never, right?

20. Auf Wiedersehen! - Goodbye!

21. Ang mga magsasaka ay nagtatanim ng palay.

22. Hindi pa ako nakakapunta sa Barcelona.

23. In conclusion, the telephone is one of the most important inventions in human history

24. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

25. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

26. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

27. Nag-usap kami kamakalawa ng tanghali.

28. Si Gng. Cruz ay isang guro sa asignaturang Filipino.

29. Sa aking paglalakad, natatanaw ko ang magandang tanawin ng bukid na pambihirang nagpapalaya sa aking isipan.

30. Nagtataka ako kung bakit kailangan ko pang maghintay ng matagal bago mo ako sagutin.

31. Mahalagang ipaglaban natin ang ating kalayaan sa pamamagitan ng tamang pamamaraan.

32. Kinakabahan ako para sa board exam.

33. Puwede bang makausap si Maria?

34. Sa ganang iyo, may pag-asa pa bang magbago ang taong matagal nang naligaw ng landas?

35. Ano ang yari ng sahig ng bahay mo?

36. Nous allons nous marier à l'église.

37. Maglalaba muna ako bago magpunta sa galaan.

38. Ano ang binibili ni Consuelo?

39. Gusto kong manood ng mga pambatang palabas.

40. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

41. The value of money can fluctuate over time due to factors such as inflation and changes in supply and demand.

42. Hindi mo aakalaing maarte siya sa mga damit dahil hindi naman ito halata.

43. Nanghiram ako ng bicycle para sa isang bike race.

44. Pagkababa, mabilis na siyang nagyayang umuwi.

45. Inilabas ng pulisya ang larawan ng salarin upang matulungan ang mga sibilyan na makakilala sa kanya.

46. Bilang paglilinaw, ang damit na dapat isuot ay kulay puti, hindi asul.

47. The concert raised funds for charitable causes, including education and healthcare.

48. Kung hindi ngayon, kailan pa ang tamang panahon?

49. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

50. Pasasaan ba't di iikli ang pila? naisip niya.

Similar Words

High-definitionhighest

Recent Searches

natingpersistent,highrawslaveevenlimitdollargrabenakakapamasyalulappinagpatuloyreceptorpaoskinakabahanmakisigtumigilipinauutangsasamahanreportdisensyoiniiroghiwagakalalaroeducatingmaskaraangkanriegagalawnapadpadolivadiedniyaginisingpagkalitonakasabitkawili-wiliunconventionaltuparinkabinataannapadaanparinkwenta-kwentaumagahinabikagabinasabitinapossabigabimacadamiathroughoutnangangaralestablishedseenlabikahusayanmaipantawid-gutomoktubregabi-gabi18thpagkainisdescargarkinumutandiagnosesdeliciosapinatawadbiologimagkaibangnakaraanmanghikayatdoble-karainiresetanamumutlanapapasayabilihinmahawaanmakikikainhiganteamerikatwinklecitizennegosyonagwagiterminopanguloorderincallinginaaminmagsabimakaratingdinanassasabihinrestaurantbinentahandingdingpakistantagpiangmungkahimaalwangmasungitdalandansinisiracompanymakawalaganidkuryentesoccerninyotoretespenttubiglumayomedyohapdisongsyumaowalongandoymajortargetkelanlinggocrossinuminstylesmaisippaanotumabiplasavisualstreetkriskangitipaga-alalabataytumahimikpatayartistasumiiyaknakalipasisugatravelerlatert-shirtnananaginipnakakatulongberegningerkalikasanselebrasyonrevolucionadocomedeterminasyonapoyformwerekungtapepaulit-ulitcashfullnababasapitomag-babaitparinag-aabanglossonline,nagsabaymagbabayadgymabimababangisjoyurimatagpuanstopalancayeypinakidalaababook:medisinaparehongmoviekabuntisankumikilospaalamkapasyahannapasigawreleasedunangihahatidtengaburdenbulsanagpatulongsay,tulonglupain