Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

2. Pati ang mga batang naroon.

3. Kakain ako ng spaghetti mamayang gabi.

4. Si Juan ay nangahas na magtapat ng pag-ibig kay Maria sa kabila ng kanyang takot na ma-reject.

5. They have renovated their kitchen.

6. Les employeurs peuvent utiliser des méthodes de travail flexibles pour aider les travailleurs à équilibrer leur vie professionnelle et personnelle.

7. Nagkakasayahan sila sa isang panig ng bilangguan

8. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

9.

10. Ano ang kinakain niya sa tanghalian?

11. Hindi malinis ang mga tsinelas ni Lori.

12. The store offers a store credit for returns instead of a cash refund.

13.

14. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

15. Gusto kong bumili ng bagong cellphone, datapwat ang aking kasalukuyang cellphone ay gumagana pa naman.

16. La película que produjo el estudio fue un gran éxito internacional.

17. Sino ang kasama niya sa trabaho?

18. Oo nga noh? Pero di bale, advance gift ng ninong. aniya.

19. Tengo tos seca. (I have a dry cough.)

20. Ang pagdidilim ng aking paningin ay nagpahiwatig ng pagdating ng masamang panahon.

21. If you think I'm the one who stole your phone, you're barking up the wrong tree.

22. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

23. Kapag nakuha na niya ang aking puso saka lamang siya magkakaroon ng kapangyarihan sa mga nilalang dito.

24. Kailangan ng mas magandang kondisyon sa trabaho para sa mga anak-pawis upang mapabuti ang kanilang kalagayan.

25. Hindi maaring magkaruon ng kapayapaan kung ang marahas na kaguluhan ay patuloy na magaganap.

26. Nais kong mapasigla ang aking katawan kaya kailangan ko ng mahabang halinghing.

27. Nag tinda si Aling Pusing ng isda upang may makain ang kanyang mga anak.

28. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

29. Hindi mo matitiis ang mga maarteng tao dahil sobrang pihikan sila.

30. Sino ang nakasuot ng asul na polo?

31. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

32. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

33. Nagpapadalhan na kami ng mga mensahe araw-araw dahil nililigawan ko siya.

34. The candidate who wins the most electoral votes becomes the President

35. Dahil sa pagkabigla ay hindi na nakapagsalita ang binata at ito ay napaluha na lang.

36. Kucing di Indonesia sering dimanjakan dengan mainan seperti bola karet atau mainan berbentuk tikus.

37. Tulad ng sinabi nito, ang ulan ay hindi na huminto pa.

38. Emphasis is the act of placing greater importance or focus on something.

39. Jeg er i gang med at skynde mig at få alt færdigt til mødet. (I'm in a hurry to finish everything for the meeting.)

40. I accidentally let the cat out of the bag about my friend's crush on someone in our group.

41. Aray! Bakit mo naman ako sinapok!

42. Ang pelikula ay ukol kay Jose rizal na lumaban para sa kanyang bayan.

43. Mathematics is an essential tool for understanding and shaping the world around us.

44. Ilan po ang lalaking pumasok sa restawan?

45. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

46. Bumoto ka nang ayon sa idinidikta ng iyong puso.

47. Pagkatapos ng malagim na balita, natagpuan ko ang aking sarili na tulala sa kanyang kwarto.

48. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

49. The police were searching for the culprit behind the rash of robberies in the area.

50. Nagiging emosyonal ang mga panahon sa kasal, tulad ng mga pananalita ng mga magulang at mga kaibigan.

Similar Words

High-definitionhighest

Recent Searches

highnagbakasyonwastebuslohimayinnakasakitartistshealthiernabigkastanggalinsinkamericannasabiugatiskokumbentolaborabenemagdamagrektanggulolalakenagbabalamagbabakasyontungopumilipaceipinagbibiliikinatatakotpodcasts,eskuwelahannapakatagalkasalukuyannakakitapunongkahoybumahalumikhanagliwanagpaglisanturismot-shirtpinakamatapatnagmakaawainilalabasespecializadaskwenta-kwentapagpasensyahanpaglapastangansalu-salotinakasanmakabilinaapektuhanpioneertumutubotravelnagpabotnapanoodpaglakikare-karepesosopisinalumayonakatitignatuwadeletingmungkahimateryalestagaytaymagpagupitmagalangtumirabankumiwasmagpakaramiminervietumindignabasafulfillmentiniuwimahuhulihinihintaymaghihintaybakitnanigasbenefitsbook,ginoonggumisingconclusion,pagpalitsasapakinsumasayawpagiisipxviiligayatengaoffentligbinatilyoentertainmentkaniyaindependentlyalmacenar3hrsengkantadabanlagahhhhsakophinanaphinahaplosumakyatkuwebaganidphilosophicalsayawanyoungbrasokaragatanilagayenglandtitobusymaskiiyanlaybrariedsafarmpitumpongthankinatakeambagboracaycellphonekabosesjoemournedpulubimaibaliktransmitidaslandosamakatwidprutasiilankamayherunderstoryjackzgabehumanofertilizerbriefmasdanallottedanimoyubodtakessenateipagmalaakinabighanipwestokauntingrightelectionheitooinalokscheduledesdebilistransparentbokmatang1973workshoppatrickinterviewingtmicanooddoingdumaramiskillextrakitreleasedsafenatatawanaggingpinilingmakaiponboxingejecutantinungocigarettenapakaraminglumipadtenidomundoginagawanalamannaglokomagkanoremote