Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Este año planeamos viajar a España durante las vacaciones de verano.

2. May ipinadala pong pakete sa akin ang ate ko.

3. Ohne Fleiß kein Preis.

4. Sobra. nakangiting sabi niya.

5. Hindi niya gustong maging nag-iisa sa buhay.

6. The hospital had a special isolation ward for patients with pneumonia.

7. Trapik kaya naglakad na lang kami.

8. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

9. Emphasis can be used to create a memorable and impactful message.

10. Ibinigay ng kumpanya ang malaking kawalan sa kanilang kita upang masiguro ang kaligtasan ng kanilang mga empleyado.

11. Bago matulog, naglalaba ako ng aking uniporme para sa darating na school week.

12. Parang tumigil ang lahat, sumabog na ang mga fireworks...

13. Gracias por ser honesto/a y decirme la verdad.

14. Puno ng hinagpis ang liham na iniwan ni Clara bago siya tuluyang umalis.

15. Crush kita alam mo ba?

16. Marami ang nagdadasal sa simbahan tuwing linggo.

17.

18. They have donated to charity.

19. Mabini ang sumulat ng konstitusyon ng unang Republika ng Pilipinas.

20. Sumulat ng tula ang aking guro sa aming klase at pinabasa sa amin.

21. The computer works perfectly.

22. Ang mga dentista ay maaaring mag-rekomenda ng mga produkto na dapat gamitin upang mapanatili ang malusog na ngipin.

23. Hindi maganda na maging sobrang mapanghinala sa lahat ng tao dahil sa agam-agam.

24. Kailan libre si Carol sa Sabado?

25. Nang mag-asawa ang mga kapatid ni Psyche, humingi siya ng payo kay Apollo kung sino ang dapat mapangasawa niya.

26. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

27. Pumupunta kami sa sementeryo tuwing undas.

28. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

29. ¿Te gusta el sabor picante del jengibre?

30. Ang mahal ng bili nya sa cellphone.

31. Kahit paano'y may alaala pa rin siya sa atin.

32. Ang takip-silim ay isang panahon kung saan maaari mong maappreciate ang ganda ng kalikasan at ng mga gusali.

33. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

34. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

35. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

36. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

37. Inakalang imposible ang kanyang pangarap, pero naabot niya ito.

38. Aller Anfang ist schwer.

39. Nagsusulat ako ng mga pangungusap sa papel upang ma-praktis ang aking bokabularyo.

40. Sa kanyang lumang bahay, makikita mo ang kanyang koleksyon ng mga antique na kagamitan na hitik sa kasaysayan.

41. Nangumbida ako ng maraming tao kasabay ng biling 'wag kalimutan ang regalo at pagbati ng �Happy Birthday,Rebo!�

42. The United States has a complex political system, with multiple levels of government and political parties.

43. Candi Borobudur di Yogyakarta adalah salah satu candi Buddha terbesar di dunia yang sangat terkenal.

44. Makinig ka na lang.

45. Meskipun mayoritas Muslim, Indonesia juga memiliki komunitas yang kuat dari agama-agama lain yang berkontribusi pada keragaman budaya dan sosial.

46. Los héroes pueden tener habilidades sobresalientes, pero también muestran compasión y empatía hacia los demás.

47. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

48. Ang pangalan ni Carlos Yulo ay patuloy na magiging simbolo ng tagumpay ng atletang Pilipino.

49. The Taj Mahal in India is a magnificent wonder of architecture.

50. Ang mailap na mga bagay ay kadalasang may halaga dahil sa kanilang kakaibang katangian.

Similar Words

High-definitionhighest

Recent Searches

highcallhoweverconsiderarpacecomunicarseedit:reallyconstitutionwhynariningmang-aawitmaypagkamanghainsidentesannagsunuransangapinagkakaabalahansinasadyagulathulupumitasrepublicnakilalakaninumanmamimilinanlilimosvaccinespagbebentatawanantienengumandavidtstraktcultivanakatapatcoachingtamanenahugishigitsurgerydidingpowersumilingnaglalakadrevolucionadonangampanya11pmnagmungkahimanlalakbaymagkaibiganhinipan-hipantwinklemaaarinakakapasokmagpapabunotnagwelgamagtanghalianmalakaskuwadernokagyatanimowatawatbilibidnagkasunogtrabajarmagsunoglumabasnanahimikmag-aaralmakikipagbabagmagpakaramilumipadsasamatalinosarongmanagergamitkapaintsakanagtatanongbilaoskillskikoroofstocktinitirhanbalingtanoddataipasoktiyapaashapingpagkakalutonakatuwaangcreatenagtatampotinulungannakumbinsipinakamatapatnakapapasongnagbigaynakagalawerhvervslivetnamanghakalayaanopisinanagdadasalasignaturamanghikayathulihanfactoresgawamakakibonakauslingpropesorbagongpwestocaracterizasukatinnakapagproposebinentahanhayopkalawakanhabitsfistsnabigkasahaspinamumunuanlalakebestidasinopagsusulitgawinghinanapkutsaritangnanayantokwalangahitkaragatankarapatannangapatdanfarmnagreplysuccessfulownmagagawabinibinitherapyelectionstuwingbluesafepagpapautangbownasundouncheckedabeneplaystalelimiteditinaapivanseparationclassroompwedepresentaadaptabilitygumisingnapakamisteryosobiocombustiblesnagtatrabahomatayogkinamumuhiansaranggolamakakakaennakapangasawakahirapannakakaakitmabigyanninanaistrasciendecellphoneekonomiyamaglaropakikipagbabaghinahanapkausapinkanikanilanginiresetasementongkumaensisentababalikundeniabletulangphilosophical