Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Bumili si Andoy ng sampaguita.

2. Ang aking kamalayan sa kultura at tradisyon ng aking bansa ay nagpapalalim sa aking pag-unawa sa aking mga ninuno.

3. Good morning, Beauty! aniya sabay halik sa mga labi ko.

4. Inutusan ng guro ang mga estudyante na ipunin ang lahat ng bola sa silid.

5. Sinundan naman siya ng mga magulang niya.

6. Les patients sont souvent admis à l'hôpital pour recevoir des soins médicaux.

7. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

8. Más vale prevenir que lamentar.

9. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

10. Isang matandang lalaki naman ang tumikim sa bunga.

11. Lumiwanag ang aking puso sa simpleng "salamat."

12. Kapag dapit-hapon, masarap mag-jogging dahil mas malamig na ang panahon.

13. Les comportements à risque tels que la consommation

14. Sinabihan siya ng magulang na huwag maging maramot sa kanyang mga kapatid.

15. Si Ana ay marunong mag-dribble ng bola nang mabilis.

16. Ang lolo at lola ko ay patay na.

17. The job market and employment opportunities vary by industry and location.

18. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

19. Baka matunaw ako. biglang sabi niya. Langya gising pala!

20. Hindi sapat ang maging bukas palad lamang sa panahon ng kapakanan, dapat bukas palad ka rin sa panahon ng kahirapan.

21. Other parts of the world like Burma and Cuba also cultivated tobacco

22. His charitable nature inspired others to volunteer at the local shelter.

23. Ano ang ginagawa mo nang nagkasunog?

24. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

25. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

26. Mahalagang magbigay ng respeto sa bawat isa, samakatuwid.

27. Ilang kilo ng pinya ang binili niya?

28. Ang paggamit ng droga ay nagpapakita lamang ng kahinaan sa tao.

29. Mahirap kausapin ang mga taong maarte dahil sa kanilang pagiging kritikal sa bawat bagay.

30. Isang araw, may nakitang halaman si Aling Rosa sa kanyang bakuran.

31. La realidad siempre supera la ficción.

32. Ikinagagalak naming anyayahan kayo sa aming kasal.

33. Tila ibig nang matuklap ang balat sa kanyang batok, likod at balikat.

34. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

35. Maraming tao ang dumalo upang manood kung mananalo ang matanda sa batang si Amba.

36. Malapit na naman ang eleksyon.

37.

38. Nanghiram ako ng pera sa kaibigan ko para may panggastos sa kape.

39. Ang malawak na mga taniman ng mga prutas at gulay ay nagpapakita ng isang industriya na mayabong at umuunlad.

40. Tradisyon na nang mga Pilipino ang pagsisimbang gabi.

41. The United States has a system of federalism, where power is divided between the national government and the individual states

42. Le travail est une partie importante de la vie adulte.

43. Waaa. Ikaw pala salarin kaya ayaw nya sa ospital!

44. Con permiso ¿Puedo pasar?

45. Kahit hindi ako nagpapakita ng kilos, crush kita pa rin sa loob ng puso ko.

46. Puwede ho ba akong kumain ng baka at baboy?

47. Quien siembra vientos, recoge tempestades.

48. Los agricultores a menudo trabajan en estrecha colaboración con otros miembros de la cadena alimentaria, como los transportistas y los minoristas.

49. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

50. Me cuesta respirar. (I have difficulty breathing.)

Similar Words

High-definitionhighest

Recent Searches

metodelabanancalldivideshigheitherdraft,inaapibasagoingmaratinggenerabafeedbackonlyeverymotionbathalaannacasesburdenincludedataerrors,efficientevolvedcreatemaptopicclockulotabawhetherpacekasingbwahahahahahapartyconsideredbahalapaglakipag-akyatejecutanmatitigaspaghihiraplayuannapakabilisumakyatpuntamakapaniwalasaradisposalareasdingdingnalulungkotnakatayoyoutube,magsusuotuugod-ugodpalibhasangumiwihangintinungoalbularyosellnakatunghayanakbinilhankonsultasyonnasasalinansuzetteflexibleanibersaryodaladalamakakalunesmetoderseeknakatalungkomagsubocandidatesupportpagkalungkotnanlilisikmahinogbumagsakunidosnalugodmaglinisdatingpisarakuwentomatabanggago-ordernangingiliddinalacompositoresmansanaspusangdollarkinakainumiyakmagalangkagandahagisdanagsisigawmaisnangkalaunandisenyongtumagaltipidkinikilalangnapiliinternalika-50matangkadstore1982bagyokapitbahaypaanonagtatakboinaabotpagkakalutodahan-dahanpresidentelumilipadngitilabasmadamipaumanhinpamilyangnilaoslittlesumisidmatarayrosaspakakasalanpangetaraylookedboracaykaringpagtatanongstaymabilisstyreselebrasyonnakainomnakapagproposedoktorapelyidomamayamilyongawatumamisbangproperlyarawnagagamitmakapangyarihanpapelnakikini-kinitaumigtadmagpapabunotmedisinakolehiyomanonoodartsrollkalakimamahalinunconstitutionalisinalangkuwadernoumuwimoneypagbabagokontingcultivarnakatagoentrancebingbingpagmamanehokalalarotumunogcardigantarcilaibinalitangdescargarrabbaplagasmagnifyarkilainfluenceshdtvpakikipagtagpo00amnagyayangcruz