Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

2. Yumabong ang pagmamahal ng mga tao sa mga hayop dahil sa mga kampanya para sa kaligtasan ng mga endangered species.

3. At nakuha ko kaagad ang attention nya...

4. Palibhasa ay madalas na nagsusulong ng mga bagong ideya at mga panukala dahil sa kanyang malawak na pananaw.

5. Mamaya na lang ako iigib uli.

6. Landbrugsprodukter, især mejeriprodukter, er nogle af de mest eksporterede varer fra Danmark.

7. Si Jeny ay bigong manalo bilang presidente ng kanilang paaralan.

8. Wala kang pakelam! O sige its my turn na!

9. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

10. Ang tagumpay ng aking mga estudyante ay siyang ikinagagalak ng aking puso.

11. Isa kang hampaslupa! saad ng matapobreng babae.

12. Hendes hår er som silke. (Her hair is like silk.)

13. Nakatanggap kami ng masamang balita na ang aking kaibigan ay nawala at ito ay lubos naming ikinalulungkot.

14. Limiting the consumption of processed foods and added sugars can improve overall health.

15. Smoking-related illnesses can have a significant impact on families and caregivers, who may also experience financial and emotional stress.

16. El cultivo de olivos es una actividad tradicional en el Mediterráneo.

17. Huwag mo nang papansinin.

18. Inutusan niya si Pinang na magluto ng lugaw.

19. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

20. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

21. Si te gusta la comida picante, prueba el guacamole con jalapeño.

22. Chris Hemsworth gained international recognition for his portrayal of Thor in the Marvel Cinematic Universe.

23. Ipagtimpla mo ng kape ang bisita.

24. Ako naman, poker face lang. Hahaha!

25. Oo, malapit na ako.

26. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

27. Ayoko pong nakakulong sa madilim na lugar na kinalalagyan ko.

28. Hinding-hindi napo siya uulit.

29. Hindi maganda ang ugali ng taong nagpaplastikan dahil madalas silang nagsisinungaling.

30. Sa Chinese New Year, ang mga pamilya ay nagtitipon upang magsalu-salo at magbigayan ng mga regalo.

31. Kleine Geschenke erhalten die Freundschaft.

32. May kanya-kanyang bayani ang bawat panahon.

33. Nakaka-in love ang kagandahan niya.

34. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

35. Bumuga siya ng hangin saka tumingin saken.

36. Ang mga natatanging kontribusyon ng mga siyentipiko sa kanilang larangan ay dapat na itinuring at ipinagmamalaki.

37. Ang aming pagsasama bilang magkabilang kabiyak ay puno ng pagpapahalaga at respeto sa isa't isa.

38. Isa-isa niyang tiningnan ang mga nakapaligid sa kanya.

39. Hindi ako makapaniwala na datapapwat ay nangyari ang ganitong kaguluhan sa aming lugar.

40. The elderly man was happy sitting on his porch, watching the world go by - sometimes ignorance is bliss in old age.

41. Ang pusa ay naglaro ng bola ng sinulid buong maghapon.

42. Ang pangalan niya ay Mang Sanas.

43. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

44. Diyan ang bahay ni Mr. Marasigan.

45. Dapat tayong magpasya ayon sa tamang paninindigan at prinsipyo, samakatuwid.

46. Mayroong dalawang libro ang estudyante.

47. Buksan ang puso at isipan.

48. Naglalaba siya ng mga kumot at kurtina upang mapanatili ang kalinisan ng aming tahanan.

49. Es común usar ropa abrigada, como abrigos, bufandas y guantes, en invierno.

50. Technology has also had a significant impact on the way we work

Similar Words

High-definitionhighest

Recent Searches

cesartificialbringdollarpreviouslyhightradisyonkayatenidonabiglakatibayangpayapanghihigitiniangatwakasmaestraipinansasahogumabotnangingilidundeniablegroceryescuelasbasketballpinalambotniyomagtanimpromisetaksigatolmakausapendvidereakmangkastilaunanguniversitiesbanallunastsinamaibigaysnobsinapaktuwangomelettemaluwangmoderneiskoipinadalabusiness,guhitshopeeawahidingsaidwalngpagodsalahehediagnosticpangingimidietprinceabriltinanggaplapitandreambuslobotocellphoneeffektivlinggomahahabahousematapospatunayanilocosartistseclipxesumasakitmanghulininongmarmaingbinatakdiyosginaganoonnatalongnataposcarbonaminnoonpitumponghomenogensindewateriniibigmataraycompositoresklasengsitawgardencapacidadbigongfatherkalongproudskyldespinaulananhinilamakalingnakabaonmadadalaexigentekapwadisensyoeksport,paliparincantidadligayaikatlongpagmasdanmaynilatalinobarrerashinalungkatliligawanmagpakaramidecreasednaantigpasasalamatpapayatumindigjeepneyhabitsvictoriadrinkskargahankaniyanagbibigayanpapalapitbusiness:paroroonajerrycafeteriafreelancernapadungawconocidossteerresearch:nakaakmarestawanfridaygranmalikotcallerbilhinschoolslimoslagaslasebidensyatransportnangyario-onlinelumangoysabihinapatnapukulungangasolinakawili-wiliaabotmauupoopisinanai-diallot,pamagatkambingrisebalancesgrammarsinkbilaolalakatedraliilanlarotshirtanitosumagot1954iconicpagkaawagabrielniconatuyosumalaspreadreallymakingandymultopracticesunique