Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The company's profits took a hefty hit after the economic downturn.

2. Galit na galit ang ina sa anak.

3. Nakatanggap kami ng masamang balita na ang aking kaibigan ay nawala at ito ay lubos naming ikinalulungkot.

4. Ang pagguhit ay puwedeng magbigay ng kasiyahan at fulfillment sa buhay.

5. Pakibigay ng malakas na palakpak ang lahat para sa ating mga guro.

6. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

7. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

8. Ano ang ginawa mo kagabi bago ka matulog?

9. No hay palabras suficientes para agradecer tu amor y apoyo.

10. Sa tindi ng init, pakiramdam ko’y nagbabaga na ang lupa sa ilalim ng aking mga paa.

11. Gusto ko pumunta ng enchanted kingdom!

12. He is not running in the park.

13. Ang mga tao ay pumili ng panibagong Sultan at kinalimutan na si Sultan Barabas.

14. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

15. Parang ganun na nga babes. Tapos tumawa kami.

16. Menos kinse na para alas-dos.

17. I usually like to tell a joke to break the ice at the beginning of a presentation.

18. Ayaw sumindi ng ilaw. Pundido na yata.

19. Tengo muchos amigos en mi clase de español.

20. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

21. Maraming mga artist ang nakakakuha ng inspirasyon sa pamamagitan ng pagguhit.

22. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

23. Det er vigtigt at have et støttende netværk af venner og familie under fødslen og i de første måneder efter fødslen.

24. Si Tom ay nag-aapuhap ng paumanhin sa kanyang mga kaibigan matapos ang kanilang pag-aaway.

25. Børn bør have adgang til sunde og næringsrige fødevarer for at sikre deres sundhed.

26. Pinadala na nya ang kanyang resignation letter sa pamamagitan ng email.

27. Si Rizal ay naglakbay sa Europa at nakikipag-ugnayan sa mga kilalang intelektuwal at lider sa paglaban sa kolonyalismong Espanyol.

28. Mabuti na rin ang nakatapos ng pag-aaral upang pagdating ng panahon ay magagamit mo ito.

29. mga yun. Ang mahalaga ay makapagempake ako agad.

30. May mga punong-kahoy na nagiging sentro ng mga turista dahil sa kanilang napakalaking sukat at ganda.

31. Alam ko na may karapatan ang bawat nilalang.

32. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

33. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

34. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

35. Sa mga hayop, ang hudyat ay maaaring gamitin sa pakikipag-ugnayan, tulad ng pagpapakita ng kilos ng buntot o ng mata.

36. Jeg har opnået stor erfaring gennem mit arbejde med at lede projekter.

37. El perro ladrando en la calle está llamando la atención de los vecinos.

38. Scissors are a cutting tool with two blades joined together at a pivot point.

39. Facebook Marketplace is a platform where users can buy and sell items locally.

40. Las serpientes juegan un papel importante en el equilibrio de los ecosistemas al controlar las poblaciones de roedores.

41.

42. La creatividad se puede aplicar en cualquier campo de trabajo.

43. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

44. Ang kanilang anak ay tinawag nilang Amba.

45. Masama pa ba ang pakiramdam mo?

46. The Grand Canyon is a breathtaking wonder of nature in the United States.

47. Marahil ay maulan bukas kaya't dapat magdala ng payong.

48. En la universidad, hice muchos amigos nuevos de diferentes partes del mundo.

49. Claro, puedes hacer todas las preguntas que quieras.

50. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng stress at pagkalungkot.

Similar Words

High-definitionhighest

Recent Searches

increasinglypossiblehighfeelingbardaigdigkinikilalanghunyosourcecontrolledprocessbituindeclarerelevantstreamingheftybasaduloenvironmentvirksomheder,nalulungkotressourcernesalamangkeropinagpatuloypunong-kahoykakuwentuhangagawinmatapobrengisulattinangkamakitaeskwelahannamumulotnagpalalimnagsagawanagnakawnapakahusaypulang-pulanagbabasatabihanmakaraanmakakibopagkaangatngumiwinagsuotdeliciosanahintakutantatayomabihisanuugod-ugodpangungusapnakikiamanghikayatginawarantotoogawainkasamaangnatanongiikutanwriting,intindihinnanunuksotemperaturanaglokohanpatakbomahuhulinakapikithanapinkusinanapakahinampasteachingskargahancynthiaxviiniyonpaliparinbinabaratbusiness:isiplazadao-orderpagkaingtiyantanganaaisshbuhoktasamagdilimrecibirpaggawaomfattendenayoniskedyulsiglokalongsoundnogensindemagbigayanpagkatarkilapangkatreviewnatagalanangalpublishing,lingidreplacedwalngexcusefamewariflaviobilugangcalciumbangkogaggodtnoelplasmaginisingoutperangnagbungarhythmpagbahingwordskamipartybernardoparagraphsbilinpinyafiaconstitutionpdaauthorfataltraininghatingpaslitioslorenaredstrategydeleencounterheitumalonwhilerangestringsettingjunjuninfinitypacebitbitplatformmanagerpracticesandycommercehellomay-arisinunodanlaborecentlymakakakaenproducererenergisignal1973maghahabitoylagaslasnagbakasyonluluwasnagtungophilanthropytaga-hiroshimagitaranunlumilipadkagipitannakangisinggovernorsngpuntaitinagopigingpangakonamadangerousclaseslandoagosgamotmaranasananteskontratirang