Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Disculpe; ¿me puede ayudar por favor?

2. Ano-ano ang mga projects nila?

3. Hinugot ko ang papel sa loob ng envelope.

4. Tengo náuseas. (I feel nauseous.)

5. Nagtataka ako kung bakit hindi mo pa rin maipaliwanag sa akin kung ano ang totoong dahilan.

6. Nakangisi at nanunukso na naman.

7. Inalalayan ko siya hanggang makarating sa abangan ng taxi.

8. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

9. Jeg er helt forelsket i hende. (I'm completely in love with her.)

10. Ang mga Pinoy ay kilala sa pagiging masayahin at matulungin.

11. Ang nagliliyab na araw ay nagdulot ng matinding init sa buong bayan.

12. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

13. Pinahiram ko ang aking golf club sa aking kaopisina para sa kanilang tournament.

14. Ito ang nabigkas ni Waldo, mga katagang mula sa kanyang puso na punong-puno ng hinanakit.

15. Samvittigheden kan være en påmindelse om vores personlige værdier og moralske standarder.

16. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

17. Kung alam ko lang na ganito kasakit ang magiging parusa ko

18. Hindi ka sigurado sa desisyon mo? Kung gayon, pag-isipan mo itong mabuti.

19. Si tienes paciencia, las cosas buenas llegarán.

20. Walang pagtutol sa mga mata ng mga ito.

21. Naghanap siya gabi't araw.

22. Les sciences sociales étudient le comportement humain et la société.

23. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

24. Sino ang nakasuot ng asul na polo?

25. The cough syrup helped to alleviate the symptoms of pneumonia.

26. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

27. Lumiwanag ang buong silid nang buksan ang ilaw.

28. Herzlichen Glückwunsch! - Congratulations!

29. Nag-aalala ako sa mga pinagdadaanan ng aking nililigawan at lagi kong inuunawa ang kanyang mga kailangan.

30. Si Maria ay malakas ang boses, bagkus ang kanyang kapatid ay tahimik.

31. At malaman ng maaga ang wasto sa kamalian.

32. Kapag tag-araw ay malaki-laki rin ang kinikita ng mga agwador.

33. Sa pamamagitan ng malalim na paghinga at pagsasanay ng pagmameditasyon, ang aking stress ay unti-unti nang napawi.

34. Bagai pinang dibelah dua.

35. Nangangaral na naman.

36. Ang abilidad na mag-isip nang malikhain ay nagbibigay daan sa paglutas ng mga problema.

37. Internal Audit po. simpleng sagot ko.

38. Ang panaghoy ng mga hayop sa gubat ay bunga ng pagkawasak ng kanilang tirahan.

39. Ito rin ang parusang ipinataw ng di binyagang datu sa paring Katoliko.

40. Hindi ko maintindihan kung bakit kailangan pang magmangiyak-ngiyak dahil sa mga simpleng bagay.

41. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan kemauan untuk beradaptasi.

42. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

43. Nakita nilang ang balat ng bunga ay manipis at maliit ang buto.

44. We sang "happy birthday" to my nephew over video chat.

45. Ipaliwanag ang mga sumusunod na salita.

46. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

47. The telephone has undergone many changes and improvements since its invention

48. He is running in the park.

49. Mahalagang magpakumbaba at magpakatotoo sa bawat sitwasyon, samakatuwid.

50. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

Similar Words

High-definitionhighest

Recent Searches

previouslyhighstrengthcomuneslibrelastingwaysmulti-billionfeelingpinag-aaralanbobbihirawakasmediumbinilingshiftelectbilingmonitortypesawareimprovededitorcomunicarsepagbabagong-anyosusundomaagaspeechesnakikilalangpaga-alalahinanakitmalapalasyoiginawadminahandescargarkumustagymparticularjuandiseasesplasakumatokmahigithoweverkelangabrielkagandaguhitmarangyangsinaliksiknaiilangkumirotnamuhaysumisilipnapatinginhabangpinipilitsementoipasokmapayapakumbentokasallumakingsandalingpanindasaadmakulongmayabongtaxiumarawnasunogtiketmedyobulagnuclearcondolikelyeffecttagpianginilabasfertilizerpaslitpromotingmagpa-ospitalkinikitalumalangoyincluirnagkasakitdesisyonannamanghakanginajejueksempeljingjinglungsodbaroconclusion,combatirlas,bilibidnanigashanapinlakadsidoomfattendelinanogensindeestilosapoyzooblazingpartytumindigshoesmarkedchefworkshopmainstreamcorrectingmagsasalitanapakahangamakapaibabawnagtatampomakitanakakagalakapatawaranrevolucionadoikinalulungkotmagbibiyahepagpapatubonagpapaigibspiritualisugaminutosnobartssinipangprimertaingameaningduonpierclientsnakatapatpagkagustopumapaligidmagpagalingkumaliwapaghihingalomaglalaronagkwentomedikaliloilomagkamalifilipinamahinangnabighanipaki-drawingnakakarinignapagtantounattendednagmadalingnagdaboginiindaadgangthanksgivingbalahiboyouthnapuyattumakaskomedormagbibiladlabinsiyamsiguradonatanongalagangnanamaninterests,magsungitnagsamalumindolisinuottrabahomaasahantalinonobodyguerrerodecreasednilaosoperativoshinamakpanginoonmagalitmagsabiumagangmawalabibigyannapakasampungnatakotmassachusetts