Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Wala na siguro sya, baka natulog na inantok na.

2. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

3. Mahalaga ang maagap na pagtugon sa pangamba upang maiwasan ang mas malaking panganib.

4. Today, Bruce Lee's legacy continues to be felt around the world

5. Magandang maganda ang Pilipinas.

6. Ano ang gustong bilhin ni Juan?

7. Itinuturo siya ng mga iyon.

8. Gamitin ang pangungusap ayon sa sinabi ng guro.

9. Noong Southeast Asian Games, nag-uwi si Carlos Yulo ng maraming medalya para sa bansa.

10. Paglalayag sa malawak na dagat,

11. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

12. Sadyang mahirap ang pag-aaral ng calculus.

13. Matitigas at maliliit na buto.

14. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

15. Gusto ko pumunta ng enchanted kingdom!

16. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

17. Nilimas ang kanilang kabuhayan at sapilitang dinala sa tabing dagat ang kadalagahang napili.

18. The art class teaches a variety of techniques, from drawing to painting.

19. Ang haba na ng buhok mo!

20. Nakasuot siya ng pulang damit.

21. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

22. When he nothing shines upon

23. Sa dapit-hapon, masarap mag-meditate at mag-isip-isip sa mga bagay-bagay.

24. There are a lot of benefits to exercising regularly.

25. Nakita kita sa isang magasin.

26. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

27. May mga salarin na gumagamit ng iba't ibang modus operandi upang mabiktima ang mga tao.

28. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

29. Ngunit hindi niya alam na nakasunod ang mga kababayang niyang walang ibang inisip kundi makakuha ng pagkain.

30. Mabini Hall ang tawag sa gusali kung saan nagsisimula ang mga klase sa Polytechnic University of the Philippines.

31. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

32. Ano pa ho ang dapat kong gawin?

33. Nosotros disfrutamos de comidas tradicionales como el pavo en Acción de Gracias durante las vacaciones.

34. Libre ba si Carol sa Martes ng gabi?

35. Sa kanyang pag-aaral ng sining, pinagmamasdan niya ang mga obra ng mga kilalang pintor.

36. Ilan ang computer sa bahay mo?

37. Walang anuman saad ng mayor.

38. El amor todo lo puede.

39. Saan nakatira si Ginoong Oue?

40. Ang mga buto ng mais ay dapat na itinanim sa loob ng 1-2 pulgada sa lupa, at dapat na itinanim sa isang distansya ng mga 8-12 pulgada sa pagitan ng bawat halaman

41. Bagai pungguk merindukan bulan.

42. Limitations can be a source of motivation to push oneself to achieve more.

43. Kakain ako ng spaghetti mamayang gabi.

44. Ang simbahan ay hitik sa mga deboto tuwing Linggo.

45. Ano kaya ang pakiramdam ng nakasakay sa eroplano.

46. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

47. El mal comportamiento en clase está llamando la atención del profesor.

48. One man, one word ka ba? Ang tipid mong sumagot eh!

49. Makapal ang tila buhok sa balat nito.

50. An omelette is a dish made from beaten eggs cooked in a pan.

Similar Words

High-definitionhighest

Recent Searches

bulastuffedhighbubongtopic,leefistsnilutoshapingbumugaexpertkakainincultivobutolumabannapakalakitinigilanmalaki-lakinakikihalubiloreftungkoltuminginmagtatanimdonationstilamagpapaikotnagliliwanagtandamaramdamansaranggolamisteryosongjeepneyrenaiakargahantatagalnagsisikainnovembermedisinasagabalpanindangmagkamalipagsusulititinanimdaraanansumindifulfillingluboshunipaalisnakakagalahihigafertilizerkasintahannatuyohateextremistsalonpaggawaipapainituniversitiesdalawinrichlungkotkuwentomagandanglarawanmateryalesmarahilhumaloluissumimangotgitnagawasuwailpamanlumiwanagpakisabingitibuwalmagkakapatidnaglalabapaga-alalapoliticallaki-lakisong-writingnapatawagkinapanayamnag-oorasyonkarwahengmahawaaninferioresnagkapilatinirapanselebrasyondadalawinmeriendakinagalitannagsisigawnananaghilipagsalakayweddingkabutihannakakamitpagkainismagpalagomoviekahulugannangangalitpagpanhikmagtataasmumuntingpaumanhinminamahalnagdadasalsiksikanmangahasnagtataeapatnapukontratamakikitulogpagkaraapawiinpagkaangatkinalakihanmagdamagannatinagrodonabowlvidenskabnaghilamosmagagamitmabatongpaparusahaninterests,minatamismakapagempaketumalonafternoonbighaniunanconvey,rewardingfreedomsbinawianisusuottherapeuticssugatangbahagyakulungannapasukoduwendemarielsayawantibokvariedaddisciplinkumaenipagmalaakikinarightsbiyernesnapapag-usapanawitinescuelasnakapagsasakayelvisbaclaransafernohmaninirahanipaghugasnapalingonjailhousesinimulananiiigiblistahankapainkuyarestaurantanihinhigh-definitionelectorallunesmaayosyeykasuutanpagkainsoccerklasrumtanodgoshmorenaonlinehverdalagangtsakanatandaantapehiningi