Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The feeling of accomplishment after completing a difficult task can be euphoric.

2. A lot of traffic on the highway delayed our trip.

3. Madalas ang anak pa ang nagagalit kapag ang pagkaing maibigan ay hindi agad maibigay.

4. Tinulungan ko siyang dalhin yung mga plato sa dining room.

5. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

6. Hindi ako mahilig kumain ng pulotgata dahil sa sobrang tamis nito.

7. Anong gamot ang inireseta ng doktor?

8. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

9. Pinaayos ng paaralan ang ilaw sa silid-aralan upang hindi na magkakaroon ng problema sa lighting.

10. Saan mo dinala ang dinukot mo sa aling ito?

11. The company's acquisition of new assets will help it expand its global presence.

12. I've been following the diet plan for a week, and so far so good.

13. People who give unsolicited advice are a dime a dozen.

14. Bitbit ng isang kamay ang isang pangnang sisidlan ng kanyang pamimilhing uulamin.

15. Wala nang gatas si Boy.

16. It is brewed from roasted coffee beans, which come from the Coffea plant.

17. Candi Borobudur di Yogyakarta adalah salah satu candi Buddha terbesar di dunia yang sangat terkenal.

18. El curry tiene un sabor picante y aromático que me encanta.

19.

20. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

21. Agradezco profundamente tu dedicación y esfuerzo.

22. Agad na ginamot ni Mang Sanas si Nam at nawala ang lahat ng kaniyang mga sakit at sugat.

23. Kapag nagkakaroon ng sakuna, ang mga volunteer ay nagiigib ng tubig para sa mga apektadong pamilya.

24. Hindi dapat natin ipagwalang-bahala ang mga babala at paalala ng mga eksperto, samakatuwid.

25. Endvidere er Danmark også kendt for sin høje grad af offentlig velfærd

26. Mapayapa ang kanilang lungsod sa pamumuno ng kanilang butihing Mayor.

27. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

28. Alas-tres kinse na po ng hapon.

29. Ang Ibong Adarna ay nagpakita ng magagandang aral tungkol sa katapangan, pagkakaisa, at pagpapatawad.

30. Dapat magkaroon ng sapat na proteksyon at benepisyo ang mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

31. Bumili ako ng bagong set ng kubyertos para sa aming bahay.

32. Nakaupo sa balkonahe, pinagmamasdan niya ang mga tao na dumaraan sa kalsada.

33. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

34. La agricultura es una carrera honorable y vital que ha existido desde tiempos antiguos.

35. Magandang gabi sa inyo mga ginoo at binibini.

36. Pendidikan agama merupakan bagian integral dalam kurikulum pendidikan di Indonesia, memungkinkan generasi muda untuk memahami dan menghargai agama-agama yang berbeda.

37. May bagong promotion ako sa trabaho kaya masayang-masaya ako ngayon.

38. Maramot ang kapitbahay nila at hindi nagpapahiram ng gamit kahit kailan.

39. Ang hirap naman ng exam nakaka bobo.

40. Bumili si Ana ng regalo para sa asawa.

41. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

42. Mayroon pa ba kayong gustong sabihin?

43. Nagsusulat ako ng mga pangungusap sa papel upang ma-praktis ang aking bokabularyo.

44. One man, one word ka ba? Ang tipid mong sumagot eh!

45. Ininom ni Henry ang kape sa kusina.

46. El dueño de la granja cosecha los huevos frescos todas las mañanas para su negocio de huevos orgánicos.

47. Las heridas en la cara o cerca de los ojos deben ser evaluadas y tratadas por un especialista en oftalmología.

48. Magkasingganda ang rosas at ang orkidyas.

49. Nagkakasya rin ang pamilya na mamulot ng mga tirang pagkain na maaari pang pakinabangan.

50. Matapos ang matagal na paghihintay, ang aking pag-aalinlangan ay napawi nang dumating ang inaasam kong pagkakataon.

Similar Words

High-definitionhighest

Recent Searches

artificialhighabspossiblewaysobstaclesipinainagaweithergapbilingestablishedjohnpointlibagmagbubungacasesuminomtaletutorialsexampleandroidputingmethodsneedsitemshateconvertingablegaanocomputernaglokohanioslatekomunidadechaveartistparehongkumikiloskalayuangulatnagsagawaisinulatmakakasahodnagliliyabkumikinigcultivapagkahaponagtitiispunongkahoynapakahangapatrickformanariningestartshirtcanadamagisipnagpuntasouthsiyudadunangpagkamanghapinabayaandon'tmag-anakvillagepiyanonagpapasasacompositorescultivarkumantamauliniganeverystrengthgrowthpagiisipnabiawanglookedmagkakagustodissenanlilisikmalapitanpaglalaitpamamasyalnagsisigawnapakahusayaregladocolorbehaviornanonoodaywanhitmajorgatasnagtakainainfinitylinesamfundnatanongmakasahodnakakatulongcablemarsosampungfriendsiguradominatamismangingisdangmagsisimulabarongagostolawsshowsmagpuntaexpectationsbanlaghinugotmakukulaylugawsiyadecreasewritepinggansapatoshitsuranagbakasyonfull-timedemocraticcancerelectedhinigitnilangpatakbonginiangatpracticadoburolbukodkitsumasakaynaglabapulongmansanasellainjurystyrerkoreanekonomiyamabirocharitablemakaraan1982kapatagannaglipanangnecesariomakikipaglaronapansinbihasapagdamiletterdulapaparusahandaminutshulungpuntakapangyarihannapakasumakitconsumasambafansnatutuloganimokamaypasahebinibilangkastilangmadungispagamutangloriacuentanaseanaga-agajejupaghaliko-onlinemakakabalikpagsahodpinapalotitakailandagat-dagatantinatanongsignalugodflyvemaskinernagsamatumamis