Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Napanood ko ang concert ng aking paboritong banda kaya masayang-masaya ako ngayon.

2. Kumaripas ng uwi si Pedro matapos niyang marinig ang masamang balita.

3. They play video games on weekends.

4. Hinding-hindi napo siya uulit.

5. Di ko sya maistorbo dahil sya ay nag-aaral pa.

6. Tumayo ako para tingnan yung itsura ko ngayon.

7. Nanalo siya ng sampung libong piso.

8. Bagay na bagay kayong dalawa. Paano ba kayo nagkakilala?

9. Paano kung hindi maayos ang aircon?

10. Natigilan siya. Tila nag-iisip kung anong gagawin.

11. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

12. Mahalaga ang pag-aaral ng talambuhay ni Marcelo H. del Pilar upang maunawaan ang kanyang papel sa kasaysayan ng Pilipinas.

13. Ako ay nagtatanim ng mga halaman sa aking bakuran.

14. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

15. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

16. Nasa harap ako ng istasyon ng tren.

17. Sa tagal nilang nagsama ay hindi sila pinalad magkaroon ng anak

18. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

19. The officer issued a traffic ticket for speeding.

20. Sa bawat tula ng makata, maririnig ang malalim na hinagpis ng kanyang puso.

21. May mga taong may kondisyon tulad ng insomnia na nagdudulot sa kanila ng problema sa pagtulog.

22. Sa gitna ng pagdidilim, mayroon pa ring mga tala na nakikita sa langit.

23. También trabajó como arquitecto y diseñó varias estructuras importantes en Italia.

24. Kailangan ng mas malawak at mas matatag na suporta sa sektor ng anak-pawis upang malutas ang mga isyu ng kahirapan.

25. Parehas na ayaw magbigayan ang dalawang pangkat at pinipilit na sila ang mas nararapat kaysa sa isa.

26. Matapos ang isang matinding pagsubok, hindi maiwasan ang paglabas ng malalim na himutok.

27. Nakasuot siya ng itim na pantalon.

28. Kumain kana ba?

29. Another area of technological advancement that has had a major impact on society is transportation

30. He is not driving to work today.

31. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

32. Pupunta ako sa Madrid sa tag-araw.

33. Pinikit niya ang mata upang namnamin ang sarap ng tsokolate.

34. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

35. Ilan ang telepono sa bahay ninyo?

36. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

37. Magandang umaga naman, Pedro.

38. Nabigla ako sa tanong nya kaya sinapak ko sya.

39. Gracias por hacer posible este maravilloso momento.

40. Huwag ring magpapigil sa pangamba

41. Hindi dapat nakatutok tayo sa mga kababawan ng buhay, kundi sa kabutihan ng ating kapwa at ng ating bansa.

42. At være transkønnet kan være en del af ens identitet, men det definerer ikke hele personen.

43. If you quit your job in anger, you might burn bridges with your employer and coworkers.

44. Nangangamba ako sa pagdidilim ng aking paningin dahil sa pagkakaroon ko ng mataas na grado.

45. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

46. She has started a new job.

47. La comida mexicana suele ser muy picante.

48. Ang malalakas na paputok ng firecrackers ay binulabog ang kapayapaan ng gabi ng Bagong Taon.

49. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan, at ang pag-aaral na ito ay nagbibigay ng karagdagang kulay sa kanyang karanasan.

50. Sa pagpapahalaga sa ating kalayaan, kailangan din nating bigyan ng halaga ang kalayaan ng iba.

Similar Words

High-definitionhighest

Recent Searches

divideshighlightsfurthereksaminternetresponsiblegeneratealinferrerwaysemphasisipinaageideapopulationtruebanksalitamakikipaglarobaranggaynakakapasokpaki-translatemakakasahodressourcernenalalaglagpangungutyapinagwikaanhumalakhaknakapapasongnaninirahannageenglishposporospiritualhitanagagandahanmakapangyarihangkinatitirikannaglalatangnagbanggaannagliliwanagnagtatakbocultivopakikipagtagpobiocombustiblesculturanag-oorasyonpinakamaartengmurang-muramasayang-masayangfrancisconakitulogkinausapmahuhulitumigilnatabunanpaghanganagpabayadkumikinignapasubsobpinabayaannakapaligidnapapasayamanggagalingkapatawarannakahigangkagalakankinauupuanghitsurapagsalakaynaglalaronalalabifilmnakakasamakasangkapanmangangahoynapapatungonapaluhaartistasmagtanghalianpagkamanghanagbiyayamakikiraannakatuwaangnananaginipisinulatnagpapakainmagasawangsapatostig-bebeintejosienapiligelaitulisannakapagproposeiiwasanpahaboltumatawadtumapospaulit-ulitnanangisdemocracymangingisdamusttanodinomtreskalakinghayarguesawatumangoinantaypatitapeuddannelseopotsakamapahamaktignanhugismembersstruggledipinasyangsetyembrepatunayanhverairconibinalitangelectoraltinuturomataposutilizarltodagatoffergiverkarapatanbangkokumatokmulighederinangthingcarmenhomenaglabananherramientaagosconsideredmalimitemaildeleearlylackproduciranimagbungacongratsstevepulakitanglarrysamuimaginationthenbipolarbinabalikitakresearch:uncheckedsobraprocesohamaksubjectbienoverallpootseekhahahapaki-ulitlologratificante,kinatatalungkuangkinatatayuandi-kawasakalalakihankasalukuyankubyertosyumabongmakakakaennagkalapitnapanoodpaki-drawingpagtataaspresence,pagkagustokalayuanpaanongnaibibigaypagtangis