Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. All these years, I have been cherishing the relationships and connections that matter most to me.

2. Sira ang elevator sa mall, kaya't napilitan silang gamitin ang hagdan.

3. Ang pasya nang pagkapanalo ay sa tela ng matanda.

4. Have we seen this movie before?

5. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

6. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

7. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

8. Matapos mahuli, nanumpa siya ng katapatan sa Estados Unidos.

9. Mila Romero ang pangalan ng tiya ko.

10. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

11. Walang password ang wifi ng kapit-bahay.

12. Matapos magbabala ay itinaas ng matanda ang baston.

13. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

14. Different types of work require different skills, education, and training.

15. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

16. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

17. Narinig ni Ana ang boses ni Noel.

18. Members of the US

19. All these years, I have been grateful for the journey and excited for what the future holds.

20. Ayos lang yun. May nagsabay naman sa akin eh. sabi ko.

21. Bawal magpakalat ng basura sa kalsada dahil ito ay maaaring makasira sa kalikasan.

22. We need to get this done quickly, but not by cutting corners.

23. To: Beast Yung friend kong si Mica.

24. May anak itong laging isinasama sa paglalaba.

25. Nangyari pa nagmistulang itong reyna kung utusan ang ama at ina.

26. Napaka presko ng hangin sa dagat.

27. Ang mahal pala ng ticket papuntang Amerika!

28. Has she met the new manager?

29. Naglalaway siya sa bango ng kape na inilabas ng coffee shop.

30. Sa baguio nila napiling mag honeymoon.

31. Sa pook na iyon, sa nakaririmarim na pook na iyon, aba ang pagtingin sa kanila.

32. Sa brainly ako madalas nakakakuha ng ideya.

33. Ginawa niya ang lahat ng makakaya niya sa kompetisyon, samakatuwid, walang dahilan para siya ay malungkot.

34. I don't want to beat around the bush. I need to know the truth.

35. May pumupunta sa Seasite minu-minuto.

36. Kailan ipinanganak si Ligaya?

37. Bumagsak ang nawalan ng panimbang na si Ogor.

38. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

39. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

40. Ang saranggola ay gawa sa papel, kawayan, at plastik.

41. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

42. Marmaing sandaling walang nangahas magsalita.

43. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

44. Ha? Ano yung last na sinabi mo? May binulong ka eh.

45. Ang aming angkan ay kilala sa aming lugar dahil sa aming mga tradisyon.

46. Kung may isinuksok, may madudukot.

47. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

48. Bakit ayaw mong kumain ng saging?

49. Ang malawak na kagubatan ay isang magandang halimbawa ng isang ekosistema na mayabong.

50. Sa wakas, aalis na si Ogor, naisip niya.

Similar Words

High-definitionhighest

Recent Searches

highcrossmatapangjolibeehubad-barolatenagtutulungannakaluhodunibersidadnagtitiisbaku-bakongganoonnagkalapitmakakakaennagcurvekutodsiniyasatkahalumigmiganbalitapinagpatuloyfotospanghabambuhaytatlumpungpagkapasokmagkakagustodingdingdumilimkasinginfinitytumikimpublicityibabawpasyanatanongnaiinismagawakulturnagtatampobilisnamumulanagsinetrabahonapakabiliscruzpahabolmaghihintaymakapalgelaividenskabpangungutyanamataylumibotmagpapigilnapapahintonagdadasalkatutubopaglapastanganpinagbigyanmovienananalongnakauwipagamutantayomagamotbowmagdamagkainitannewspaperskutsilyobumuhoslangkaylinakaniyamabutitelevisionsiraalmacenarumigibpagkanaturalisipaninteligenteshinogangkanfilmsmaaarisarakulaypiginglivessusulitinihandaedsamalikotmakabilibaotamadmaliitmalambotingatanmaariadicionalesikinagagalakmayroonsipabestklasrumgamitinmaskiarguechoipalaypersistent,matalimpaglayasdrewparoipinalittagtuyotuulitinnakapaglaropinapataposeffectslulusogeducativasmaghaponfertilizertanimninongiiwanbataybossstillparagraphscongressritwalpshleytemodernnyasakyanmaitimbahaykinagabihanmamitastaglagaskinaumagahanpamamasyalitinaashinalungkatmainstreamacademyeditnatingsinungalingclassmatetools,palabaspinilitnamapagkatakotmatakawmamidogcebubelldelegatedburdenscientistdontginisingloritenflashbasahinkristosmallpatidinadaananbatomarioplantassubalitasimmaestromakisigwordsilbingabrilpeacengingisi-ngisingdreamguhitthirdburmapintuanbisitapebreropiecesnatutulog