Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Matumal ang bentahan ng bulaklak ngayong lockdown.

2. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

3. Soto ayam adalah sup ayam yang dimasak dengan rempah-rempah Indonesia khas.

4. Sa tahanan, ako'y nakatulog nang matiwasay sa aking malambot na kama.

5. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

6. Naghanap siya gabi't araw.

7. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

8. Maaliwalas ang simoy ng hangin sa probinsya.

9. Mucho gusto, mi nombre es Julianne

10. Hindi ako sumang-ayon sa kanilang desisyon na ituloy ang proyekto.

11. Kailan ipinanganak si Ligaya?

12.

13. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

14. Napatingin ako sa menu. Parang nagc-crave ako sa hotdog.

15. They are a great way to use up leftover ingredients and reduce food waste.

16. El arte renacentista fue una época de gran florecimiento del arte en Europa.

17. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

18. La paciencia es una cualidad que se debe cultivar.

19. Påskeæg er en traditionel gave i påsken og er ofte fyldt med slik eller små gaver.

20. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

21. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

22. Ano ho ba ang itsura ng gusali?

23. Some limitations can be temporary, while others may be permanent.

24. Elektroniske apparater kan hjælpe med at forbedre præcision og nøjagtighed af forskellige opgaver.

25. Sa pagpaplano ng kasal, kailangan isaalang-alang ang oras ng seremonya upang hindi maabala ang mga bisita.

26. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

27. Ang mga lumang talaarawan at dokumento ay dapat na itinuring bilang mahalagang bahagi ng kasaysayan.

28. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

29. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

30. Nakapagpropose ka na ba talaga? pagtatanong ko.

31. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

32. Anong nangyari sayo? Bakit hinde ka nagkakakain?

33. Eine hohe Inflation kann das Wirtschaftswachstum verlangsamen oder stoppen.

34. Las plantas pueden entrar en un estado de dormancia durante el invierno, reduciendo su crecimiento.

35. I'm going through a lot of stress at work, but I'm just trying to hang in there.

36. Ang pagkakaroon ng mapagkakatiwalaang kaibigan ay siyang ikinagagalak ni Carla.

37. Il fait beau aujourd'hui, n'est-ce pas?

38. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

39. Amazon started as an online bookstore, but it has since expanded into other areas.

40. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

41. El agua cubre aproximadamente el 70% de la superficie del planeta.

42. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

43. Kapag bukas palad ka sa mga taong hindi mo pa nakikilala, mas maraming taong pwedeng maging kaibigan mo.

44. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa pag-iisip, emosyon, at pisikal na kalusugan ng isang tao.

45. Pede bang itanong kung anong oras na?

46. Dime con quién andas y te diré quién eres.

47.

48. Ano ho ba ang masarap na putahe ninyo?

49. B-bakit mo pinatay yung ilaw?! biglang tanong ni Cross.

50. Sa Chinese New Year, ang mga tao ay nagbibigay ng mga pabuya upang pasayahin ang mga diyos at mga espiritu.

Similar Words

High-definitionhighest

Recent Searches

highlayuninyonoverviewpinilingbroadexpertstorespeedislapasangprovidetriptsaagracebilanginsuwailexpresanpamanbakaniyogbawalginawanyankumbentonilutolibagvalleymabaitklasengmatapangherramientapinagmamalakijuegospaghalikmaagainulitcourtnagmasid-masidbuwayakinahawaiiporkasuutankendibumuhoslasapumupuricultivopatiencesellingbuhokkailanpitumpongparurusahanriyanwasteideyadikyamdaddynapakaramingbecamecurrentlangkaybaoumanopamimilhininfectiousnanghahapdimagbabakasyonnanghihinapinakamatabangmagtanghalianpunongkahoypoliticalnagmakaawamakapangyarihangmurang-muranagkakatipun-tiponbabasahini-rechargeturismoisasabadpinagkiskissasabihinnagpabotibinubulongnakalipasnag-iisapagsumamoglobalisasyonpanghabambuhaykinagalitanwarialapaapautomatiskculturesnasilawtotoongkalabawmagpagupitkongresokuripotprodujonasaanginvestmagdoorbellmedicinesinaliksikmalawakarturokasinakikitakindergartenmisyunerongbenefitskontraginoongsahigcaraballofulfillmentlibertynaabotisasamakassingulangchickenpoxisamaalasmonumentomatipunodeterminasyoninfluencesinakyatsumisilipngipinggulangjobkaysakatolikolabahintinikmaintindihandisposallaybrarilumilingonmeanskinainmalihisinatakethankbateryasundaepaksamakahingicapacidadadvancecarmeninomnobledaladalaresumensinkiniinomsigniilannicotreskalakingdahanayokowashingtondapatdietprincenoomaisuboddulottikettoretebuslotaingaingatanencompassesxixcitizenhikingtopicdahan-dahannagsisipag-uwianmaidibinibigaytonyritwalbulakalakallottedshowsbinawimadamijudicial