Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Pakibigay ng respeto sa mga matatanda dahil sila ang unang nagtaguyod ng ating komunidad.

2. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

3. Está claro que debemos tomar una decisión pronto.

4. She's trying to consolidate her credit card debt into a single loan with lower interest rates.

5. All these years, I have been striving to be the best version of myself.

6. Habang nakaluhod, dalawang kamay niyang tinutop ang pisngi.

7. Waring may nais siyang sabihin, ngunit pinili niyang manahimik.

8. Nag-enjoy ako sa pag-aaral ng isang bagong wika kaya nahuhumaling ako sa pag-aaral ng iba pang wika.

9. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

10.

11. Puwede ho ba akong pumasok sa klase?

12. Mag o-online ako mamayang gabi.

13. Sa mga basurahan, naglipana ang mga langaw na nagiging sagabal sa kalinisan.

14. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

15. Natandaan niya ang mga panunuksong iyon.

16. Nationalism is often associated with symbols such as flags, anthems, and monuments.

17. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

18. They have already finished their dinner.

19. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

20. Ang kanyang determinasyon ay nagliliyab habang nilalabanan ang mga pagsubok sa buhay.

21. Ang takip-silim ay isa sa pinakamagandang panahon upang maglakad-lakad sa gabi.

22. Kukuha lang ako ng first aid kit para jan sa sugat mo.

23. Nagbabakasyon ako tuwing Abril.

24. Nasa loob ng bag ang susi ko.

25. The company used the acquired assets to upgrade its technology.

26. Det er en dejlig følelse at være forelsket. (It's a wonderful feeling to be in love.)

27. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

28. Habang naglalakad ako sa dalampasigan, natatanaw ko ang malalaking alon na dumadampi sa baybayin.

29. Naabutan niya ito sa bayan.

30. Traveling to a conflict zone is considered very risky.

31. Setiap orang memiliki definisi kebahagiaan yang berbeda-beda.

32. I finally finished my degree at age 40 - better late than never!

33. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

34. Mabait na mabait ang nanay niya.

35. Sa malamig ngunit maliwanag nang sikat ng araw, nakikita na niya ang langkay ng mga agwador.

36. Nagkatinginan ang mag-ama.

37. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

38. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

39. She is playing with her pet dog.

40. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

41. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

42. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

43. Mayroon pa ba kayong gustong sabihin?

44. Nakatira ako sa San Juan Village.

45. The beauty store has a variety of skincare products, from cleansers to moisturizers.

46. Con permiso ¿Puedo pasar?

47. Binuksan ko ito at binasa yung nakalagay.

48. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

49. His speech emphasized the importance of being charitable in thought and action.

50. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

Similar Words

High-definitionhighest

Recent Searches

ceshighhalagapreviouslynagtrabahoimagingtomabsgenerateferrereffektivtgabi-gabiuddannelsepagdiriwangaraw-arawbagamatpoliticalnalulungkotnaglalakadgumagalaw-galawisinulatkinagalitanmiyerkolespagpapautangpinagalitankagandahagkinikitamakakasahodlimasawasisentaorderkahaponhinimas-himasinasikasoinaabutannakasandigmahawaankumikinignapakagagandamatapobrengkahulugannakakatandapioneerbumitawdaramdaminnapakamothampaslupanaguguluhanpagtataasmagkaharapnapapikitnaglokohanjingjingculturasmagagamitumiimikvideosintindihinmakapangyarihangnapalitangvillagekinumutanmakakabaliklalakadnaliwanaganuugod-ugodpagkainisngumiwiitinuturingevolucionadonavigationnakiisainiuwimagamotpaostumigilkommunikererfysik,buwenastactokastilanganumangsiyudadbinentahantagpiangkatolisismosapatosnabuhaylumipadbinuksanrightsmaghapongnakapikitmandirigmangpagkataposmasungitsakyanpagsusulitasukalvaledictorianriegaloveuwakpagmasdantalinoawitaniniirogpadalasniyog1970snabigkasmagisipbanlagligaligcompletamenteninahinukaytmicamalawakbarongberetihadlangheybilanginmataasgigisingnocheamendmentsangkopannikaumagatamadginaganoonrosellerestauranttambayanfarmsaraknightpinagnyananiyabusyalaalahugishinogilocospopularlandebumotokinainestarsinapakkantokablanbotantebilaolegislationailmentsmahahabalarobalitanakikitasiguromagulangscientificjokedalandanfireworksnagbungaseestaple1980sellmagpuntapasanlatercommunicationschadpingganscientistabenetheynitongintopollutionmainitstatusiosnilutomacadamiaofferwealthniyantiyasafestoplightipihitdarkhim