Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ano ang nahulog mula sa puno?

2. Ayaw na rin niyang ayusin ang kaniyang sarili.

3. Muchas ciudades tienen festivales de música que atraen a personas de todo el mundo.

4.

5. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

6. Ang pagkakaroon ng kinikilingan sa kabila ng malinaw na ebidensya ay nagpapahiwatig ng pagiging bulag sa katotohanan.

7. Ang mabuti ho yata, e dalhin na natin iyan kung dadalhin.

8. Nasaan ba ang pangulo?

9. He was already feeling embarrassed, and then his friends started laughing at him. That added insult to injury.

10. Gusto. pag-amin ko kasi gutom na gutom na talaga ako.

11. El dibujo de la anatomía humana fue uno de los mayores intereses de Leonardo da Vinci.

12. Bukas ay magpapabunot na ako ng ngipin.

13. En México, el Día de los Enamorados se celebra con una fiesta tradicional llamada el Día del Cariño.

14. Saan kami kumakain ng mami at siopao?

15. That article might not be completely accurate, so take it with a grain of salt.

16. Beauty is in the eye of the beholder.

17. Naku hindi na po. Ayos lang po ako.

18. They are cooking together in the kitchen.

19. Ang kahusayan ng isang guro ay dapat na itinuring at kilalanin ng mga mag-aaral.

20. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

21. Bawal magtapon ng basura sa dagat dahil ito ay nakakasira sa buhay ng mga isda at iba pang karagatan.

22. Hindi iniinda ng magkakapatid na Lala, Dada at Sasa ang nakapapasong init ng araw sapagkat ito ay nagpapakinis pa nga ng kanilang kutis.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. Limitations can be perceived or real, and they can vary from person to person.

25. Nosotros nos disfrazamos y vamos a fiestas de Halloween durante las vacaciones.

26. Ang puso niya’y nagbabaga ng pagmamahal para sa kanyang pamilya.

27. We have been painting the room for hours.

28. La vista desde la cima de la montaña es simplemente sublime.

29. Mahalagang igalang ang kalayaan ng ibang tao sa pagpapasiya ng kanilang mga sariling buhay.

30. I have been learning to play the piano for six months.

31. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

32. Tuwa at sigla ang dala ng saranggola sa bawat bata.

33. Lumbay na naman si Jose matapos matalo sa sabong.

34. Ang sugal ay maaaring magdulot ng labis na stress, pagkabalisa, at pagkabahala sa mga manlalaro.

35. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

36. La tos crónica dura más de ocho semanas y puede ser causada por una variedad de factores.

37. "A barking dog never bites."

38. My daughter made me a homemade card that said "happy birthday, Mom!"

39. El Día de San Valentín es una festividad muy popular en muchos países.

40. Ang mga salaysay tungkol sa buhay at mga gawain ni Rizal ay naging paksa ng mga akademikong pag-aaral at pagsasaliksik.

41. Durante las vacaciones de Semana Santa, asistimos a procesiones religiosas.

42. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

43. Masayang-masaya ang kagubatan.

44. "Huwag kang matakot, kaya natin ito," ani ng sundalo sa kanyang kasamahan.

45. Claro, estaré allí a las 5 p.m.

46. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

47. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

48. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

49. Hindi ako sang-ayon sa mga desisyon ng aking mga magulang tungkol sa aking buhay.

50. They do yoga in the park.

Similar Words

High-definitionhighest

Recent Searches

merebabehighincreasinglykaharianpracticadoturismoihandamaipagmamalakingmakahihigitlorybusbungapeopleencuestaslobbyiwanmawaladiretsomahigpitpamilyatinungosolsementeryoparkingikatlongsakopsagapkantanakatingingbinatangimportantesilaeventsleftubodpumililugawpatience,makapagempakemaglutohmmmmpabalikbowlnearimposibledrinksbodatissuemabuhaymalilimutincornerkagabilinggo-linggokagandahanpagtatanimflamencomagsasamanatulakmariahetokalawakanhojashaceralakbrindarmakisigmasyadongdumagundongreservationopohinihintayumaasanaghihinagpismakasalanangpahahanaptruevariedadkasalukuyancommander-in-chiefmasungitamingpalasyonahahalinhankesonakangisingnaghihirapnapatulalamagpasalamatpumayagpoongnakilalakamiaspaglalabapinakalutangmangyayarihayopkahusayanwikangabutterflyperangmagpaniwalahawimabutituyotbastabumabamakapagsabiyakapmaglalabakinamumuhianmagtatagalpresidentialnakaliliyongpagluluksanakaramdamnakakadalawnapakamisteryosokaloobangnagwelgakagalakanhitsuramamanhikanpagkamanghanapatawaginspirasyonpulang-pulaikinalulungkotlumalakikapamilyanagdiretsomahihirappagtangisgulatmahiwagangmakatarungangmakahiramalas-diyeslumiwageconomymulaacademymahiyahulumananalosundalopinapataposnagkasakitnakakarinignahintakutankasintahanpakikipagbabagphilanthropylalarganakabaonna-curiouspantalonggagamitnagtapossementongkainitanmatumalpaligsahanbangkangpapuntangsusulittagalogpinilitkumuloglinggonagkabungamatustusanmarianmatangremoteotsoalmusalumiyaknapakalungkotmakabangonprosperpagsambafewenduringkoryenteyangparaangipinansasahogunconstitutionalkundimanmaranasanunosnabiglapulgadakoreabayanibinabaratmobilekabarkada