Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Good things come to those who wait

2. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

3. Nagbabaga ang mga damdamin ng magkasintahan habang nag-aaway sila.

4. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

5. Many people work to earn money to support themselves and their families.

6. Wag mo naman hayaang mawala siya sakin.

7. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

8. Ang manunulat ay nagsusulat ng nobela na nagpapakita ng kaniyang malikhain na imahinasyon.

9. Bakit ba gusto mo akong maging bestfriend?!

10. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

11. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

12. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

13. Kinuha nya yung wallet nya at inabot yung bayad.

14.

15. Ang tunay na pag-ibig sa bayan, ay hindi lamang sa panahon ng kaginhawahan.

16. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

17. Unti-unting gumuhit ang ngiti sa mga labi niya.

18. Bakit ba nagkaroon ng landslide at baha?

19. Bawal magdadala ng baril sa loob ng paaralan dahil ito ay delikado sa kaligtasan ng mga estudyante.

20. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

21. Nagsusulat ako ng aking journal tuwing gabi.

22. Matagal na kitang nakikitang namumulot ng mga kahoy sa gubat na ito.

23. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

24. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

25. Aalis siya sa makalawa ng umaga.

26. Bilang paglilinaw, ang pondo para sa event ay galing sa donasyon, hindi mula sa pondo ng paaralan.

27. Di Indonesia, bayi yang baru lahir biasanya diberi nama dengan penuh makna dan arti.

28. Ayaw ko ng masyadong maanghang/matamis.

29. She opted for a lightweight jacket to wear during her morning run.

30. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

31. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

32. Pagputi ng uwak, pag-itim ng tagak.

33. Tatlong linggo kami dito sa Pilipinas.

34. Ako nga pala si Nicolas, kinagagalak kitang makilala.

35. Siya ay maramot sa pagbibigay ng tulong kahit marami siyang pera.

36. A lot of birds were chirping in the trees, signaling the start of spring.

37. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

38. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

39. The wedding photographer captures important moments and memories from the wedding day.

40. Mag-uusap kami sa makalawa ng tanghali.

41. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

42. Sobrang mahal ng cellphone ni Joseph.

43. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

44. Si Tony ay nakapagtapos sa elementary at nagging balediktoryan

45. A father is a male parent in a family.

46. The surface of the football field can vary, but it is typically made of grass or artificial turf.

47. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

48. Biglang lumiwanag ang paligid at si Ipong ay naging hipon.

49. Over-emphasis can be counterproductive and may undermine the intended message.

50. Las labradoras son perros muy versátiles y pueden adaptarse a una variedad de situaciones.

Similar Words

High-definitionhighest

Recent Searches

highmaghihintaysawanakaupobahagyapadalasmaipapautangapologeticlulusogsincebiocombustiblesgumagalaw-galawkayang-kayangressourcernepatutunguhannapatawagmedya-agwanagbabakasyonmoviesmakapangyarihangmamamanhikannaninirahannakaluhodpinapasayanagpabayadbumisitanageespadahanpamumuhaysasagutinnaghuhumindigmagsi-skiingcarsalas-diyescultivareconomyhimihiyawibinibigaynagkasakitstrategiestinakasanmahiyanaibibigaypagkagustopakikipagbabagtravelmalapalasyomakauwisalbahengnapasubsobsinusuklalyannakabibinginglumilipadmusicaleshoneymoonyakapinnaglahonakahugmagandangpaanotutusinsalamintig-bebeintenagsinetuktoksiguradopumulotuniversitynagsamanabuhaypundidoproduktivitetsigurolikodbinitiwantuyoisinaragusalivitaminparaangsamantalangalagangsementongbalikatmalawakpakaininarabiakulisapisubolagaslasniyaumigiblittlehumigasahodsikatnahintakutanpatikenjibulongdadalobagamashoppingcocktailrolandnasasiraheartbeatkumustamamarilkarangalannoonpsssedsanakabritishwednesdayhagdanmakinangmatigastinitindasabogpatingbinulongbumotopasalamatanhuwebespriestbingikalakingsemillasiniinompasigawhappenedhetosapagkatnag-usaplaylaychadchesscondodeathcuentanyanpedejeromeforcesstrategymatindingpingganjackyhurtigereguhitkantoprincepopularizeduonfuelipinadalasipaokaysuccessbukodencompassesgranknownscientificredesexamatentomoodbienzoomsamfundjosh1980explainmediumdulomessageuloeffectbituindeclareuniquethinkthreestyrertawadfacilitatinggrabefarcomputeremaputianimprivateenchantedmakilingstrengthkasinggandared