Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

2. Las heridas infectadas pueden requerir de antibióticos para su tratamiento.

3. Sinundo ko siya at pumunta kami sa ospital.

4. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

5. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

6. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

7. Ang taong lulong sa droga, ay parang nakakulong sa isang piitan na hindi makalabas.

8. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

9. Videnskab er systematisk undersøgelse af natur og universet ved hjælp af metoder som observation, eksperimentering og analyse

10. Puedes saber que el maíz está maduro cuando las hojas inferiores comienzan a secarse y las espigas están duras al tacto

11. Biglang bumangon ang hari at hinugot ang espada.

12. Hindi ko alam kung bakit hindi ka pa rin nakakapag-move on sa kahit anong nangyari.

13. Pang-isahang kuwarto ang gusto niya.

14. Danmark eksporterer også mange forskellige typer af maskiner og udstyr.

15. Dyan ka lang ha! Wag kang lalapit sakin!

16. Ang reception ng kasal ay nagbibigay ng pagkakataon para ipagdiwang ang bagong kasal at kumain ng masarap na pagkain.

17. All these years, I have been inspired by the resilience and strength of those around me.

18. Sa pulong ng mga mag-aaral, ipinahayag nila ang kanilang mga mungkahi upang mapabuti ang pasilidad ng paaralan.

19. Napatigil ako sa pagtawa ng seryoso nyang sinabi yun, Eh?

20. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

21. Dumating na sila galing sa Australia.

22. Siempre hay que tener paciencia con los demás.

23. Kami ay pabalik na diyan sa kaharian, pasensiya na sa masamang balita.

24. Las labradoras son perros muy versátiles y pueden adaptarse a una variedad de situaciones.

25. Eh bakit nakalock ha?!!! Explain mo nga!

26. Lumiit ito at nagkaroon ng mga mahahabang paa.

27. Limitations can be a source of motivation to push oneself to achieve more.

28. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

29. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

30. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

31. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

32. From there it spread to different other countries of the world

33. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

34. Ako muna sabi, e, giit ni Ogor.

35. Hang in there."

36. Sa ganang iyo, ano ang pinakamagandang gawin upang mapaunlad ang ating bayan?

37. Taking unapproved medication can be risky to your health.

38. Kaninong payong ang dilaw na payong?

39. Binibigyang halaga ng mga Pilipino ang talambuhay ni Ninoy Aquino bilang isang martir at simbolo ng demokrasya.

40. Mon mari a fait une surprise pendant notre cérémonie de mariage.

41. Ang mga halaman ay dapat na pinapakain sa regular na may compost o fertilizer upang matiyak na sila ay may sapat na nutrients para sa paglaki

42. Ang Ibong Adarna ay nakapagbigay ng inspirasyon sa maraming manunulat at makata upang magsulat ng kanilang sariling mga obra.

43. Sa pagkakatumba ni Aya, nanlilisik pa ang mga matang tumingin sa ama.

44. Hindi dapat natin kalimutan ang ating mga responsibilidad, datapapwat ay may mga pagkakataon na napapabayaan natin ito.

45. Agama juga sering menjadi landasan bagi hukum dan kebijakan di Indonesia, dengan prinsip-prinsip agama tertentu tercermin dalam sistem hukum negara.

46. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

47. Los héroes son modelos a seguir para las generaciones futuras.

48. Makabalik na nga sa klase! inis na sabi ko.

49. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

50. She is not cooking dinner tonight.

Similar Words

High-definitionhighest

Recent Searches

babehighpreviouslydinggintomtrainingferrerconsiderarpagkagustomanipisipinabulaoverviewvasquesactivitybaketdesigningpamamagitanberkeleyoftenbetweenquicklyedit:charitableapollostatingsquatterechave2001steeryearstanghaliankapilingexamplemakapilingneedssolidifybataexisttabletumagaldependingwaitbinilinglutuinowncallpowertinaasaneskuwelahannabalitaannagtatanimcollectionsestasyongoshnormalchumochosmarsomalakinakapagngangalitculturalpokerremainfilmpaga-alalamakikipagbabagbabaliklangawnagmamadalitatanggapinnodnakalilipaspagpapasankumilosnagkasunogtuloynagpalalimdeliciosanagawangmanghikayatpakelammateryalesnakihalubilonagbantaytemparaturabagyongdreamsnakabilidettemayroonothers,marmaingsangkalandiinitinaponpabulongmanahimiktherapyikinasasabiktungonagpalipatkasamaangtinuturodistancessarisaringsubject,writing,botantenananalongmatangdiyabetispulalandepagiisipkamaliancramevitaminsnaririnigmakatayodinbarcelonatagumpaymabigyanexigenteknow-howjustotrassellingumiisodrestawranipinambilisumasaliwvehiclesvivamissionorganizegayameansdigitalmapaikotbehaviorunamasdaneventsbranchdelegatedgraduallypaacigarettenakahantadsinunodfistscompartenpagbahingritwalpananakotbosesmakalaglag-pantyyukomalalakikombinationbrucenapatawadnangingitngituulitinsimbahacardigannagsibilinapapatungomakapanglamanguboddistansyabridenalagutanpaslitpaghusayanmagka-babykabundukanmamimissrespectkalabanbeganamerikapaparusahannapapasabayrespektivenakukulilinatitiratayongsarapiyoncarsnailigtaskutsaritangparikabuhayanpagdiriwangbutihingnagtitinginanwalis