Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Napuno ng mga tao ang mga lansangan, kaya't ang lungsod ay hitik sa kasiyahan sa selebrasyon ng pista.

2. Paliparin ang kamalayan.

3. Eh bakit nakalock ha?!!! Explain mo nga!

4. Ang mga mangingisda ay nagtatanim ng mga alon sa kanilang pagmamahal sa karagatan.

5. Nagtitinda ang tindera ng prutas.

6. Ang mga Pinoy ay kilala sa pagiging masayahin at matulungin.

7. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

8. Nagpasensiya na lang si Aling Rosa, napagsilbihan naman siya kahit paano ng anak.

9. Samantalang si Perla naman ay masipag at masinop sa kabuhayan.

10. Humahaba rin ang kaniyang buhok.

11. Nanalo siya ng sampung libong piso.

12. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

13. nadama niya ang bagong tuklas na lakas niyon.

14. Ang daming palamuti ang nakalagay sa kanyang cake.

15. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

16. Madalas sya nagbibigay ng pagkain sa pulubi.

17. Wala yun. Di ko nga naisip na makakatulong. aniya.

18. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

19. Ginagamit ang "ani" bilang pamalit sa "sabi ni" kapag inilalahad ang sinabi ng isang tao sa isang usapan o kuwento.

20. Ang galing nya maglaro ng mobile legends.

21. Ada berbagai macam jenis doa, seperti doa harian, doa syukur, doa permohonan, dan lain sebagainya.

22. Palibhasa ay mahusay sa pagbasa ng mga komplikadong mga aklat at materyales.

23. Baket? nagtatakang tanong niya.

24. Obvious. tawa nanaman sya ng tawa.

25. At noon, higit kailanman, naging hamak sila sa pagtingin ng lahat.

26. Marahil ay maaga kang dapat umalis upang makarating sa pupuntahan mo sa oras.

27. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

28. Hindi po ba banda roon ang simbahan?

29. Katamtaman ang pangangatawan ng nanay ko.

30. She has been exercising every day for a month.

31. They do not ignore their responsibilities.

32. Nakita niya ang isang magandang babae sa kaniyang harapan.

33. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

34. Maligo kana para maka-alis na tayo.

35. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

36. Después de la tormenta, el cielo se vuelve más oscuro y las nubes se alejan.

37. Ibinigay niya ang kanyang tiwala sa akin upang mamuno sa proyekto.

38. Mas maganda pa ring magpatawad kaysa magtanim ng inis sa puso.

39. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

40. Ang bilis naman ng oras!

41. Kung ano ang puno, siya ang bunga.

42. Napansin ni Rabona na kumakapal ang buhok nito sa katawan.

43. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

44. The king's reign may be remembered for significant events or accomplishments, such as building projects, military victories, or cultural achievements.

45. Masyado siyang tulala sa kanyang pangarap at hindi na niya napapansin ang totoong mundo.

46. May dalawang puno sa harap ng bahay namin.

47. Lazada has a strong focus on customer service and has won awards for its efforts.

48. Ibinigay niya ang kanyang pagmamahal at pag-aalaga upang masiguro ang kaginhawahan ng kanyang pamilya.

49. Sa pagsalubong ng Bagong Taon, ang langit ay hitik sa mga kulay sa pamamagitan ng mga paputok at mga fireworks display.

50. Ang kalayaan ay nagbibigay ng inspirasyon at lakas ng loob sa bawat isa upang ipaglaban ang kanilang mga pangarap at layunin.

Similar Words

High-definitionhighest

Recent Searches

tiposhalagahightekadiwatanghudyatulingstringrefpatrickcallingedit:menufallafaculty1982generationspagpanhikimbesnag-iisipmarahilasaunfortunatelyistasyondumagundonginuulammiyerkolesnapagtantokuligliggrowthupuansino-sinohopeibinigayinakyattrafficpasalamatansubjectdeathatefigurespilingipongstaplelungsodtennisbiocombustiblesmaglalakadpaanomatiwasaylot,gustingnoodnagsilapitvillagemagitingairportpagtatanongnumbercigarettesdamitinulitikinatatakotnakaluhodmataaas1876encuestasplantasmagpasalamatkilalang-kilalakumakantakolehiyoitinatapatmagbalikpagbabayadnapapahintolinggonghumiwalaysasagutinnagpakitadesigninghimihiyawglobalisasyonmag-ibaerhvervslivetnakikilalangvideos,ibinubulongibonsalbahenginsektongavailablenamumulotkagalakangratificante,nagbanggaanpakikipagtagpotinakasanlansangannandayamahiyakasamaangnaiilagancultivarbumisitahawaksamantalangkristonatuwacanteenisinagotpumikitnakalipaspaglingontinanggalgarbansosdiferentessanganagpaalamnagkwentocellphonesiguroendviderewakasnatitirangpagbatinakabaonsasabihintumawagnapilitangkaniyaipagmalaakiengkantadakinatatayuaninstitucionesandreaebidensyagreatlyrestawransakimbooksdiaperbuwayaguroasiatictamaplagasexpresantusindvisofrecensalbaheharapanmatangkadpalipat-lipatguhitmaaarinaggalagabrielnagpuntanakabalotshinesbulaksimbahanspaghettifuncionarestudyantebakasyonrektanggulofederalgoshdaladalatiniosinimulanbinasadyipsawapanayinantoksilbinglumaking1940bukodtransmitsipaliwanagnapakasinungalingpulisbinabaanleytedyanculturaestablishpinalutoshowsgamotsumakitkokaknamulattobaccofacilitating