Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Arbejde er en vigtig del af voksenlivet.

2. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

3.

4. Scissors can be sharpened using a sharpening stone or taken to a professional for sharpening.

5. Bilang paglilinaw, ang parangal ay ibibigay sa buong grupo, hindi lamang sa isang tao.

6. They are not singing a song.

7. The king's family and heirs are often closely watched by the public and the media.

8. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

9. Some people have a sweet tooth and prefer sweet flavors over others.

10. Nagsisindi ng ilaw ang mga bahay tuwing takipsilim.

11. Nangahas ang bata na tawirin ang ilog kahit hindi marunong lumangoy.

12. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

13. Naglakbay siya sa ibang bansa upang hanapin ang hinugot niyang inspirasyon.

14. Malilimutin si Lolo kaya’t lagi niyang hinahanap ang kanyang salamin.

15. Galing lang ako sa mall. Naggala lang ako.

16. Erfaring har vist mig, at det er vigtigt at have en positiv tilgang til arbejdet.

17. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

18. Los motores de búsqueda nos permiten encontrar información específica en línea.

19. El genio de Da Vinci no solo se limitaba al arte, también tenía una mente científica y matemática muy desarrollada.

20. Twinkle, twinkle, little star.

21. Wala siyang dalang payong, samakatuwid, nabasa siya ng ulan.

22. Yumabong ang pagmamahal ng mga tao sa mga hayop dahil sa mga kampanya para sa kaligtasan ng mga endangered species.

23. Proper maintenance, such as regularly oiling the pivot point and cleaning off debris, can prolong the lifespan of scissors.

24. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

25. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

26. Mababa ang sahod sa trabaho, kaya naghanap siya ng ibang mapagkakakitaan.

27. Sino ang kasama niya sa trabaho?

28. May bagong aklat na inilathala ukol kay Manuel Quezon at tungkol ito sa pag-unlad ng teknolohiya.

29. She has adopted a healthy lifestyle.

30. Ayam goreng adalah ayam yang digoreng dengan bumbu khas Indonesia hingga renyah.

31. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

32. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

33. All these years, I have been striving to be the best version of myself.

34. I have finished my homework.

35. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

36. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

37. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

38. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

39. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

40. Hindi na niya kaya ang mabibigat na gawain dahil mababa ang kanyang lakas.

41. Ein frohes neues Jahr! - Happy New Year!

42. Eating a balanced diet can increase energy levels and improve mood.

43. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

44. Nag-aapuhap siya ng dispensa mula sa simbahan para sa kanyang mga nagawang kasalanan.

45. Wala nang iba pang mas mahalaga.

46. Namangha si Nicolas sa kanyang narinig sapagkat unang beses lang siyang nakarinig ng dalagang natutuwa sa mga palaka.

47. Les régimes alimentaires restrictifs et les comportements alimentaires obsessionnels peuvent nuire à la santé mentale.

48. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

49. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

50. I know this project is difficult, but we have to keep working hard - no pain, no gain.

Similar Words

High-definitionhighest

Recent Searches

ibabaetofatalschoolexithighcolourspeedtrackhardpublishinguloreturnedmitigateclienteinvolvebroadcastingseparationipihithapdiimpactedfeedbacksamaanimonlinedilawideyamakalinghotelnakaraanrosellekasalananarguenapadpadsharmainenaglalabatinutopnakapamintanashowsguerrerokainnagwelganaiilaganelevatoruugod-ugodakoisasamamaghaponvegasenergy-coalmachinesgustingnaggingsapatmagpa-checkupnagsunuranadakayadaladalatryghedtiyabinilingnangangahoynalalaglagvirksomheder,kailanmanmag-plantlibingmagkaroonrevolutioneretdahan-dahannag-iisaunti-untieskuwelafollowing,pamamasyalkapangyarihangbumibitiwpinag-aralankusineroemocionantenamumutlanahihiyangnakatalungkonaguguluhannami-missnagsmilemedicinematagpuanpresidentemagpagupittanggalinnakayukototoonaglahongunidoshouseholdinuulcertabingpoorerpagkaawamusicalesjuegoscanteenkristotrentapagbibironasaanevolucionadopumulotpagbabantamisyunerongpasahepagmasdanhinilaakmangbinge-watchingnalangnapawiadvertisingawitinhumigananoodhinugotipinansasahoglugawutilizantagalbyemaghahabipamumunonapapikitothersricomatesaquarantineinfusionesnapapatinginpagdamitagakbitiwangraphicmadurasboracaypriestposts,ilocosnapatinginexhaustedgrammartinitirhannakadisseginaganoonsarapinagroboticiniibigpeppyouepebreroayudasenatediamondomelettejacerestawanpagealakmabutingwalletdrewdeleimaginationtekstlaylaysorryteachkartongkommunikererkinayabantulotnotebookdebatesdarkpracticadolastingumilinglikelybaldetargetmahiyamakapilingwaitexistconvertingtopicattackbitbitinaapi