Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang mga kawani sa serbisyo-publiko ay dapat na itinuring bilang mga tagapaglingkod ng bayan.

2. She has finished reading the book.

3. She burned bridges with her friends by spreading gossip about them.

4. Maaaring magbigay ng libro ang guro sa akin.

5. Winning the championship left the team feeling euphoric.

6. They are singing a song together.

7. The Tesla Model S was the first electric car to have a range of over 300 miles on a single charge.

8. Lumbay na naman si Jose matapos matalo sa sabong.

9. Hindi naman yan iniisip eh! Pinapakiramdaman!

10. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

11. Napaluhod ang datu kasama ng kawal.

12. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

13. Las drogas pueden tener efectos devastadores en la vida de las personas.

14. Les élèves doivent travailler dur pour obtenir de bonnes notes.

15. Pakibigay ng halimbawa ng mga salitang magkasalungat sa klase.

16. Oo nga, yung last time eh nung birthday ko pa. ani Genna.

17. Different? Ako? Hindi po ako martian.

18. The momentum of the ball was enough to break the window.

19. Women make up roughly half of the world's population.

20. Ang bawat isa ay may bahagi sa pagpapabuti ng bayan.

21. Ang nababakas niya'y paghanga.

22. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

23. Anong kulay ang gusto ni Andy?

24. Napakalungkot ng balitang iyan.

25. Ang kanyang presensya sa aming pagtitipon ay lubos naming ikinagagalak.

26. Nag-aabang sa langit, sa mga ulap, sumisilip

27. Ang mga matatamis na melodiya ng kundiman ay nakakapukaw ng damdaming umiibig.

28. The impact of the pandemic on mental health has been immeasurable.

29. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

30. Hindi sadyang nagkaubusan ng pagkain sa aking ref.

31. Cryptocurrency operates independently of central banks and governments.

32. Medarbejdere kan arbejde i forskellige områder som finans, teknologi, uddannelse, etc.

33. Buhay ay di ganyan.

34. Mamimili si Aling Marta.

35. Emphasis can be used to create a sense of drama or suspense.

36. Ang mga bayani ay nagpapakita ng disiplina at determinasyon sa paglutas ng mga problema ng bayan.

37. He is taking a walk in the park.

38. Ang ilong nya ay matangos naman ngunit bukaka ang mga butas.

39. Les astronomes étudient les étoiles et les galaxies.

40. El cultivo de hortalizas es fundamental para una alimentación saludable.

41. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

42. Nagbago nang lahat sa'yo oh.

43. The two most common types of coffee beans are Arabica and Robusta.

44. Nosotros decoramos el árbol de Navidad juntos como familia durante las vacaciones.

45. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

46. Hala, change partner na. Ang bilis naman.

47. Biglang kumaripas ng takbo ang magnanakaw nang makita ang mga pulis.

48. Dahil sa kanyang matapang na pagtindig, naligtas niya ang mga pasahero sa agaw-buhay na sitwasyon.

49. Ang pagbisita sa mga magagandang tanawin o pook turistiko ay isang nakagagamot na paraan upang mabawasan ang stress.

50. When the blazing sun is gone

Similar Words

High-definitionhighest

Recent Searches

highcandidatedingginlightstipospreviouslytipiddulaconsiderarpapuntaputilockdownnagsisihanandrespitakachavitlasingeropinalutobatibobomegetbusyangipanlinisbossplacemedievaldalawasulsabihingmalapadhangaringpoloallowingleocigarettesjoshdoktorroboticdolyaroutlinesairportloriadverselyscientistresearch:reducedrestawanamongcallerfridayboksingtryghedibabayouryearbuwayakasinggandadumatingtrackaddressadventpalayanumanonilutorequierenfinisheddragonsumangtsaafansdeleabstainingbeintelackiconmentalnag-uwiprogramsandroidulinggitanasevolveddoingsalapiipinalitbetweenhomeworkfuturerefhighesttabalibrorememberpaceadaptabilityenchantedsumalaemailpedeagosmalabomamimaaringmatangadditionglobalwordsmatindingumiinitnaroonstudentsadditionallydaddypartnerrateidea:publishingcolourellenscheduleshockagilityspaabalanagliliwanagpapasaagricultoresnapakahusaynakapagreklamoeskuwelahangobernadornapaplastikangratificante,cornerstabing-dagatmagkikitanakakapagpatibaypagbabagong-anyomoderntangekskayang-kayangmawalapagkakapagsalitamahigitpaglisansiniyasatkumaliwamensajesnapaiyakmind:dekorasyoneskuwelapagkahaponanlilisikkinauupuangkikitapagkuwaclubnakalipasnagpaalamfilmnakalilipasnagtatamponagtuturopinakamatabangnagmakaawaressourcernenakapapasongrevolucionadovideos,nakatunghaynagmamaktolspiritualkutodlaylaypumitasmalapalasyopanalanginbeautynakakarinignaulinigannanlalamigpinamalaginagcurvekapasyahandeliciosatungawmanghikayatpronounmakasilongs-sorrynamuhaykapintasangpabulongnaaksidentenai-dialmakapalnaghilamosmagtakaincluir