Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Børn skal have mulighed for at udforske og lære om verden omkring dem.

2. Kasama ang aking kabiyak, nalalampasan namin ang mga pagsubok at hamon na dumadaan sa amin.

3. Wala na siguro sya, baka natulog na inantok na.

4. Bahay ho na may dalawang palapag.

5. Walang mahalaga kundi ang pamilya.

6. Isang magnanakaw ang nagsanib-puwersa upang mabuksan ang vault ng bangko.

7. Maya-maya lang, nagreply agad siya.

8. Naiinggit ako sa ibang hayop at halaman na tuwang-tuwa kapag may handaan sa kagubatan.

9. She has a poor credit history due to late payments and defaults on loans.

10. Ang kaniyang dugo ay nakakagaling ng mga sakit.

11. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

12. Robusta beans are cheaper and have a more bitter taste.

13. El arte renacentista fue una época de gran florecimiento del arte en Europa.

14. El que espera, desespera.

15. Dahil ika-50 anibersaryo nila.

16. Limitations can be financial, such as a lack of resources to pursue education or travel.

17. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

18. Kumakanta kasama ang Filipino Choir.

19. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

20. Napakaganda ng mga pasyalan sa bansang Japan.

21. Ang kwento sa pelikula ay ukol kay Aristotle na lumaban sa katiwalian.

22. Mencapai tujuan dan meraih kesuksesan dapat memberikan perasaan kebahagiaan yang mendalam.

23. Tengo dolor de garganta. (I have a sore throat.)

24. Sa ganang iyo, dapat bang palawigin pa ang curfew hours sa ating lungsod?

25. She spends hours scrolling through TikTok, watching funny videos and dance routines.

26. Nagsimula na akong maghanap ng mga magagandang lugar upang dalhin ang aking nililigawan sa isang romantic date.

27. Dahil sa kanyang natatanging kakayanan, naging tanyag ang bata sa iba't ibang lupalop.

28. Cryptocurrency can be used for both legal and illegal transactions.

29. Ang mga marahas na eksena sa mga pelikula ay maaaring magkaruon ng masamang impluwensya sa mga manonood.

30. Musk has expressed a desire to colonize Mars and has made significant investments in space exploration.

31. Inalok ni Maria ng turon si Clara.

32. Inakalang magaling na siya sa sakit, pero bumalik ang mga sintomas.

33. Red horse? Ikaw? nagtatakang tanong ni Genna.

34. Mahalaga rin ang pagkakaroon ng mga kaibigan sa panahon ng pag-iisa.

35. The Lakers have a rich history and are one of the most successful franchises in NBA history.

36. Balak kong magluto ng kare-kare.

37. Merry Christmas po sa inyong lahat.

38. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

39. Sa pagpapakumbaba, maraming kaalaman ang natututunan.

40.

41. Les frais d'hospitalisation peuvent varier en fonction des traitements nécessaires.

42. Naramdaman kong nag vibrate yung phone ko.

43. Para cosechar la miel, los apicultores deben retirar los panales de la colmena.

44. Subalit ang mapayapa at matiwasay na pamumuhay ng mga taga-nayon ay biglang binulabog ng masasamang-loob.

45. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

46. Gusto ko dumating doon ng umaga.

47. Ang salarin ay gumamit ng pekeng pangalan upang makaiwas sa pagkakakilanlan.

48. Work can also have a social aspect, providing opportunities to meet new people and make connections.

49. Bukas ay pupunta kami sa isang medical mission.

50. Ang kalayaan ay hindi lamang tungkol sa pagiging malaya sa pagpapahayag ng ating mga saloobin, ito rin ay tungkol sa pagpili ng ating mga sariling desisyon at pagpapasya sa ating buhay.

Similar Words

High-definitionhighest

Recent Searches

highlibredaratingemphasiswaystombosesislabulastudentpinunitratetakepromotingtwinkledisensyobetweendoingcontroladumaramicreatingeditorgapbilingbitbitsummitjohnsofakitparatingnatingikinalulungkotpanginoonbarung-barongpa-dayagonallipadnangyayarikutsilyopaketeschooltumawanaglalaroannaydelserlandlinecomputere,pagsidlannalugmokmagulangpagkapitasmagdugtongauthorsalamintawagbighanitindahanabutannaminmrslibrarysultanmisusedbokrolewordsdigitaldebatessquattersafehoweverpapelcorrectingrobertgoingpuntaallowedcontentpanatagkayregularnaninirahansportspagkagustomagpa-checkupnagpakitanakapasokpagtataasyumabongmagkamalipaghihingalonapakamotsasagutinminamahalkumaliwasusundomakawalagawinmagtagosenadorbyggetnapatulalabalahibouulaminkamandagpagigingsomethingkapatawarannapaiyakmagpagalinghumalakhakmagasawangnagkakasyamerlindanagsisigawwalngyanpulgadastatepanonoodantesvegasniyoeksport,lever,kabighanewsbihirangpawiinmananalomagtigilibinibigaymakatulogmaliwanagmakaraanpandidiriyakapinibinaonnapilimagsungitkainitannai-dialpaglulutopabulonghistorygusting-gustosagotmatalimpangakonagdaostagalsaronggasmencredittransportationawardatensyondiseaseinventioncalidadmariloutilakambingtelaeducativasmeanhealthkaugnayanincidencenasannegosyolaruanpagputibuntispag-irrigatetrajerestawranlihimkahilinganrevolutionizedtsakapasalamatankapainriseelectoralkarapatandibapaskongeffektiv1929democracyadangipapaputoltradebinulongtanodsigacitizenk-dramastartteka