Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Hindi maganda ang ugali ng taong nagpaplastikan dahil madalas silang nagsisinungaling.

2. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

3. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

4. Les enseignants peuvent adapter leur enseignement en fonction des besoins et des niveaux de compréhension des élèves.

5. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

6. Bumibili si Erlinda ng palda.

7. Mathematics is an ever-evolving field with new discoveries and applications being made constantly.

8. Natanong mo na ba siya kung handa na siya?

9. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

10. Ipinakita nya ang determinasyon sa larangan ng boxing.

11. Sa aking balkonahe, natatanaw ko ang pagsikat ng araw sa silangan.

12. Sa aling bahagi ng pelikula ka natawa?

13. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

14.

15. After finishing the marathon, the runner was euphoric with their achievement.

16. Natatakot kang mabigo? Kung gayon, huwag mong sayangin ang pagkakataon na subukan.

17. Drømme kan være en kilde til trøst og håb i svære tider.

18. When life gives you lemons, make lemonade.

19. Ang pagtanggi sa mga paniniwala at opinyon na hindi pabor sa sarili ay nagpapakita ng pagiging bulag sa katotohanan.

20. Ang COVID-19 ay laganap sa buong mundo.

21. Nagkaroon sila ng maraming anak.

22. Disfruto explorar nuevas culturas durante mis vacaciones.

23. Gumawa ng pangit na drowing ang kaibigan ko.

24. Ang sugal ay isang laro ng pagkakataon na kadalasang nagbubunga ng pagkatalo kaysa panalo.

25. Hubad-baro at ngumingisi.

26. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

27. Leonardo da Vinci diseñó varios inventos como el helicóptero y la bicicleta.

28. She reads books in her free time.

29. Ang kanyang negosyo ay lumago nang husto, samakatuwid, nakapagbukas siya ng panibagong branch.

30. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

31. Ang paglapastangan sa mga propesyonal at kanilang propesyon ay isang paglapastangan sa kanilang dedikasyon at pagsisikap.

32. Paano tayo? Di mo pa sinasagot yung tanong ko. aniya.

33. Ang panayam sa radyo ay ukol kay Doktor Jose Rizal na tumulong sa mahihirap.

34. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

35. ¿Cuánto cuesta esto?

36. Dapat supilin ng pamahalaan ang mga kriminal na nagpapahirap sa mga inosenteng mamamayan.

37. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

38. Yumabong ang pagmamahal ng mga tao sa mga hayop dahil sa mga kampanya para sa kaligtasan ng mga endangered species.

39. Ang pangamba ay maaaring maging mabuting tagapag-ingat upang maiwasan ang posibleng peligro.

40. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

41. Hindi ako makapaniwala sa nakikita ko.

42. Ang taong na-suway sa kautusan ay maaaring pagmultahin o parusahan.

43. Banyak jalan menuju Roma.

44. Bawal magpakalat ng basura sa kalsada dahil ito ay maaaring makasira sa kalikasan.

45. Nangahas ang bata na tawirin ang ilog kahit hindi marunong lumangoy.

46. Matayog ang pangarap ni Juan.

47. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

48. Kakain ako ng spaghetti mamayang gabi.

49. Ilan ang mga puno sa bakuran ninyo?

50. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

Similar Words

High-definitionhighest

Recent Searches

hightungawumiiyakmakabilimatabasaktankingdommaskkalikasansiemprepaketethingmakauuwicenterrosaschildrennagsalitaemailpaghalakhaksumindipagraranastaksimagkasakitnagdadasalmanonoodtraveleritinuturingstatenagtakanapagtantobatodigitalnanlilimahidramdammagsasakakare-karekumaripashampaslupaknightlacknagpakunotvelfungerendeumarawzooincidencekumirotlabahinbulapatrickinvolvereturnedilogprogresskulisapinaapimanirahangamotnalasingpaggawakainanwellclubbinatiangkansuotpunong-kahoynakakaakitcoachinghablabafollowing,maulitreviewersresearchabundanteoffentligviewsearchmakahingicreatebuwenasmatsingmabibingipapapuntapagdudugomananagotfreeculturetumakbotinungoibinaonmasyadonowpalagipaanongweddingmaalwangconsistnababasapapaanomagkamalimasarappasensyakaninomagkapatidyatakahitpinamalagihumahabamagpakasalkapasyahansawagawingovernmentbetatinanongmainitkasamaanincreasemakukulaycosechasmanggagalingsinisirevolucionadolisensyapasyalannapansingroceryknowledgenagkantahannakaakyatjosefaupuanpaki-chargehindefionabingipasyaatensyonggoinggubatanongmariejoseloobmaliitbinatangnaglokonagtatrabahonabiawanglolaikinasasabikconsideredbusykatabingpambatangna-suwayanyousureroapoysyabaulbobpahiramnakapangasawaamerikanagtrabahosalamangkerofestivalesmangyarikandoyoktubrerepublicantulisanmadurasnakataasakmangtiyapakikipaglabannakangisinakuhangvidenskabadvertisingfirstsarapinakamaartengpepeyounghumigamatapangwerelandeiskedyullayuancapitalpatiencemaipagmamalakingfeeltalinopiyanopansamantala