Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Emphasis is often used to highlight important information or ideas.

2. Maraming bansa ang nagkakaisa upang magbigay ng tulong sa mga bansang naapektuhan ng digmaan.

3. Nagtaas na nang pamasahe ang trycycle.

4. Maging ang mga diyosa ay kanyang hinamak na wala na ngang makahihigit pa sa galing niya.

5. Wag ka na lang pumunta sa Palawan. aniya.

6. Napakaganda ng loob ng kweba.

7. Bukas na lang ako pupunta sa bangko.

8. En invierno, la nieve puede causar problemas en el transporte, como retrasos en vuelos y cierres de carreteras.

9. Sorry, I didn't catch your name. May I know it again?

10. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

11. Hinde kasi ako mapakali kaya pumunta ako dito.

12. Siguro nga isa lang akong rebound.

13. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

14. Tahimik ang buong bahay, waring walang tao sa loob.

15. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

16. Sebagai bagian dari perayaan kelahiran, orang Indonesia sering mengadakan acara syukuran atau kenduri.

17. Bagay na bagay sayo ang suot mong damit.

18. Ang talumpati ng senador ay ukol sa mga reporma sa edukasyon.

19. Me da miedo pensar en lo desconocido, pero al final, "que sera, sera."

20. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

21. The culprit behind the product recall was found to be a manufacturing defect.

22. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

23. Las escuelas tienen un impacto significativo en el desarrollo de los estudiantes y su futuro éxito en la vida.

24. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

25. El uso de drogas puede ser un síntoma de problemas subyacentes como depresión o ansiedad.

26. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

27. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

28. El arte puede ser interpretado de diferentes maneras por diferentes personas.

29. Pininturahan nila ang bahay ng puti upang magmukhang maaliwalas.

30. Ibinigay ng titser ang libro sa estudyante.

31. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

32. Sa panahon ng digmaan, madalas na nangyayari ang mga krimen laban sa karapatang pantao.

33. Bawal magpaputok ng paputok sa hindi pagkakaroon ng pahintulot ng lokal na pamahalaan.

34. Nanalo siya ng award noong 2001.

35. May I know your name so we can start off on the right foot?

36. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

37. Maglalaro nang maglalaro.

38. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

39. Isang tanod ang dumating at sinabing may dalaw si Tony

40. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

41. Walang puno ang hindi hitik sa bunga.

42. Binalita ng magkasintahan ang kanilang kasal at ang nakatakdang araw ng pamamamanhikan.

43. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

44. Nous avons renouvelé nos vœux de mariage à notre anniversaire de mariage.

45. Ayaw niya ng maarteng palabas kaya lagi siyang nakatago sa kanyang kwarto.

46. Es importante leer las etiquetas de los alimentos para entender los ingredientes y la información nutricional.

47. I love you so much.

48. Kapag umuulan, hindi puwedeng maglaba ng mga damit sa labas.

49. Protecting the environment requires a collective effort from individuals, organizations, and governments.

50. Maaaring magdulot ng sakit sa kalooban ang mga dental problem, kaya't mahalagang agapan ito upang maiwasan ang mas malalang kalagayan.

Similar Words

High-definitionhighest

Recent Searches

kundihighdiwatamakikitulogpalagiboholhiniritprosesodinaluhankayang-kayangibonnaniniwalalabannakikiaiwinasiwasnilamarchbukasgiverkatutubotuloymariangmanyweddingpakiramdamayawgamitinotherswalayourmediummessageopgaver,magbigaylawamalakitanghalibinulabogmag-asawamakaininternalpayongumalispinauwinunomendiolabigyannahantadhaponintramurosattractivecontrolledtiemposmahihirapsundaemapalangitpalapagguidanceparoroonanatuloyagostonananaginipinspirasyonpamburakanyasimbahanerlindakapangyarihangnagtungobibisitanakasandigpangyayaripumapaligidluluwaspakinabangannaglulutoberegningerdisfrutarmagkasamasinehanakmangseryosongnagbabalanagsamamagkaibatilgangadvertisingeroplanonagpasangawingprotegidopeppymasipagnamasumpaintuladiguhitownmadurasnapatingalaalamidutilizareachingteachformas18thlateboteklimareducedletformtakereportaniinumincafeteriajuanitopamanprogramming,maratingheftyorasannagmamaktolnagaganapnagmasayahinnapatigilcorporationmasayang-masayangmalulungkotlaganapnakabibingingaudio-visuallykaniyadibisyonnatuyodomingomangpobrengsawsawanniyangisatabaslucylegacynatatakoteconomymarkgenerosityjuanaadvancementssilangtextolangostanagpalalimpinagmamasdandalisakalumangmaingatsaan-saanmagbungabahagyamabilisbiggestfriestotooeducationalbaboydiddamitmaiingaydagokpag-isipanhapasinyeahnagsabayyumaocuidado,doublemanuscriptcolormanunulatubodsusunduinlindolavailableshoppingentoncesnaiisiplangisawarenacentistanaabotmalawaknagpabotaddressnakasimangot