Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Siya ay tulala at di maka-react nang maigi sa nangyayari sa kanya.

2. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

3. Pinagmamalaki ng mag-asawa ang kanilang anak dahil hindi lang maganda si Lorena kundi ay matalino at may mabuting kalooban din.

4. Emphasis can be used to highlight a person's strengths and abilities.

5. Ang pagkakaroon ng positibong pananaw ay makatutulong sa pagharap sa mga hamon ng buhay, samakatuwid.

6. Lumabas na rin naman ako pagkatapos.

7. Hindi ko maintindihan kung ano ang nangyari kaya ako ay tulala sa kawalan.

8. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

9. Tumama ang aming kapitbahay sa lotto.

10. El tamaño y el peso del powerbank pueden variar según la capacidad de la batería.

11. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

12. Mahiwaga ang espada ni Flavio.

13. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

14. Naku wala yun, pagngiti ko dun sa babae.

15. Don't waste your money on that souvenir, they're a dime a dozen in the market.

16. Las plantas de interior son populares para decorar espacios dentro de las casas u oficinas.

17. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

18. Napakalaki talaga ng isla sa boracay.

19. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

20. Inakalang nanalo siya sa laro, pero may mas mataas pa palang puntos ang kalaban.

21. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

22. Television has also had an impact on education

23. Ano na nga ho ang pamagat ng palabas ninyo?

24. Inflation kann auch durch eine Erhöhung der Arbeitskosten verursacht werden.

25. Translation: I cannot change the past, I can only accept it with "what will be, will be."

26. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

27. Los océanos contienen la mayor cantidad de agua en la Tierra.

28. Ang republika na itinatag niya ang unang demokratikong republika sa Asya.

29. Salamat at hindi siya nawala.

30. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

31. Børn med særlige behov har brug for ekstra støtte og ressourcer for at trives.

32. Kebahagiaan adalah hasil dari kepuasan, keseimbangan, dan rasa bersyukur atas apa yang kita miliki.

33. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

34. Masyadong mahal ang pagkain sa hotel.

35. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

36. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

37. Emphasis can help to ensure that a message is received and understood by the intended audience.

38. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

39. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

40. Busog pa ako, kakatapos ko lang mag merienda.

41. Dedication is the driving force behind artists who spend countless hours honing their craft.

42. Hinanap nila ang magandang babae upang pasalamatan ngunit wala na ito.

43. She decorated the cake with colorful sprinkles and frosting.

44. Ibinigay ng aking mga kaibigan ang kanilang suporta at pagsuporta sa aking mga pangarap.

45. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

46. Kikita nga kayo rito sa palengke!

47. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

48. Los powerbanks suelen tener puertos USB que permiten conectar diferentes tipos de dispositivos.

49. Electric cars can help reduce air pollution in urban areas, which can have positive impacts on public health.

50. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

Similar Words

High-definitionhighest

Recent Searches

vishighpdatrueauthorinformationenforcingpromotingofteelectedit:completescalemasterspreadnegativebasainteligentescirclehulingcorrectingimprovedleftpuntamarkattackmethodssyncdatashiftsolidifyyeahpatrickentrygitarainteractbitbitemphasizedpinagmamalakituwangmahalnakamithardinmalalapadkagustuhangmerchandisekaramisumuotnapakahusaypumatolcomplicatedturismosasagutinpamanpinangalanangtag-ulanmedianteharisilangmemoriaminervienagsibilicommunicatenaminbagonapapasayaetsywalonggumagamitumiinommagkaibangmagkamalinananaghilikarunungannakapasokmagasawangbibisitanagpapaigibmagtatagalnagtitindanagpakitanakakitapagluluksakumukuhamarangyangpagsahodnaglulutohayaanglumuwaspagkaraanangangalitpandidirisagasaanmahiwagatumalonkuwentogawinmagkasakithanapbuhaykamandaguulaminkulunganbalahibobangkanghagdanansalaminpinauwikapintasangmaghihintayrodonakumampibutikinagbabalanai-dialnatuwatinataluntonstorypagtatakaprincipalespeksmanpamagathurtigerepadalaspantalongkabighapropesorpapalapitnaiiniskainitanculturesbinentahanpinagpapaalalahananvegasnanigasanteskanayangkauntikontrafreedomshistoriatalagangseryosointernetpulongforskelpangakocandidatesawitinbunutanbibiliresearch,bumagsaknagpalitpasyalanlaruaniyakparehasmartialmatayogpulitikoguidancebutodiseaseanitobutchyourself,anihinhomekaugnayanrisemakinangpusaambisyosangabangannaisiphouseeffektivcitizennakasuotdemocracybinulongsigabingicomputere,tryghedmisapakainsakinmedievalahitelitecupid1000natutulogagosprivatehallprobablementebabaemajor