Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Pumapasok siya sa unibersidad araw-araw.

2. A couple of lovebirds were seen walking hand-in-hand in the park.

3. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

4.

5. Puno ng hinagpis ang liham na iniwan ni Clara bago siya tuluyang umalis.

6. Nasa harap ng tindahan ng prutas

7. Nagtawanan kaming lahat sa hinirit ni Kenji.

8. Tulala lang rin yung daddy niya sa amin.

9. Murang-mura ang kamatis ngayon.

10. May tatlong telepono sa bahay namin.

11. Athena.. gising na. Uuwi na tayo maya maya.

12. En algunas regiones, el invierno puede ser muy frío y peligroso para la salud si no se toman las precauciones adecuadas.

13. It is important to identify the cause of frustration in order to find a solution and alleviate the negative feelings associated with it.

14. La salsa de chile es una de mis favoritas, me gusta el sabor picante.

15. Nagdiriwang sila ng araw ng kalayaan.

16. Tiyakan ang kanyang pagkakapagsalita; ibig niyang sa pagkalito ng bata sa pag-aapuhap ng isasagot ay masukol niyang buung-buo.

17. Børn bør lære at tage ansvar for deres handlinger og træffe gode beslutninger.

18. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

19. Ang mga kabataan ay kailangan ng edukasyon tungkol sa mga masamang epekto ng pagkakaroon ng sira sa ngipin at hindi pagpapatingin sa dentista.

20. She joined a charitable club that focuses on helping the elderly.

21. The objective of football is to score goals by kicking the ball into the opposing team's net.

22. Pare-pareho talaga kayo mga babaero!

23. Kanser ang ikinamatay ng asawa niya.

24. Lumaganap ang panaghoy ng mga magsasaka dahil sa kakulangan ng tubig para sa kanilang pananim.

25. Eine Inflation kann die Verbraucher dazu veranlassen, Waren und Dienstleistungen zu kaufen, bevor die Preise weiter steigen.

26. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

27. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

28. Einmal ist keinmal.

29. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

30. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

31. Internal Audit po. simpleng sagot ko.

32. Ang bukas palad na pagbibigay ay hindi palaging tungkol sa pera, pwede rin naman itong mga bagay na hindi nakakalat.

33. Si Maria ay malakas ang boses, bagkus ang kanyang kapatid ay tahimik.

34. Emphasis can be used to provide clarity and direction in writing.

35. Ang paglalakad sa tabing-dagat tuwing umaga ay nagbibigay sa akin ng isang matiwasay na karanasan.

36. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

37. Las serpientes son reptiles que se caracterizan por su cuerpo largo y sin extremidades.

38. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

39. Sa Chinese New Year, ang mga pamilya ay nagtitipon upang magsalu-salo at magbigayan ng mga regalo.

40. Es importante educar a los jóvenes sobre los riesgos y peligros del uso de drogas.

41. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

42. Naglakbay siya sa ibang bansa upang hanapin ang hinugot niyang inspirasyon.

43.

44. Ang pangalan niya ay Ipong.

45. Napuno ng mga tao ang mga lansangan, kaya't ang lungsod ay hitik sa kasiyahan sa selebrasyon ng pista.

46. Umikot ka sa Quezon Memorial Circle.

47. Ang aming washing machine ay madalas magamit dahil halos araw-araw kaming naglalaba.

48. The patient had a history of pneumonia and needed to be monitored closely.

49. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

50. Sa dapit-hapon, masarap tumambay sa beach at mag-enjoy sa tubig.

Similar Words

High-definitionhighest

Recent Searches

exiteksamhighnagtatakbofar-reachingkambingpaglalabasulyapltonagsisipag-uwiansorekinauupuangmanamis-namisnakakatakoto-orderheftynakatuonestudyanteblogtumahimiktumigilpananakitcalciumdumadatingsiniyasatmaaridulainuulamflyvemaskinermisusedprotestaumokaykuligligirogpaga-alala1950sboholeconomicsinisitasamarumiaddictioncnicobiyernesnewmag-ibabawianpondodissepabalangwatawatmanuscriptdinanasmataraybilugangimagingkapagbateryakamaopinipilitbabalikkalyesaan-saantaga-suportaexcuserichtextobaliklumisanfaultfatalipongeskuwelahansharingtuktokmakatatlo1000pangakotaposmakaiponipag-alalanagkwentonaghihinagpismalapitanuboreducedhila-agawannakitulogtumabasumakaynakayukohimutoktumutubobinge-watchingpara-parangpaglalaitpaghugospublishedlumalakihinagpisnakatuwaangsambittakeslungsodbalediktoryankutsaritangtinawagnagliliwanagkakuwentuhanmakikipag-duetokasalukuyanhimigmiravelstandpamilihannakatalungkopagtangisinilalabasdahan-dahanbestfriendmagpaliwanagpagsumamokumikilossisidlanliv,elijeandinyoloanskapemagpagupitricanamataymalapalasyopacienciatanggalinmedicinetatayomagkamalinaiilaganinuulcersistemasbalahibohanapbuhaymagpasalamatsinaliksiknaglokotumalimkinalilibingannaiisipna-fundditoisasamalumiitlever,nakangisingkailanmandamdaminnilaostulisannaiinisgovernorsmag-orderpresentationmakasalanangnasaananak-pawisnagniningningpumulotdiyaryocruzpagbabantatumamarenacentistaginagawaedukasyonpagkagisingunidosnatuwamansanasaustraliamatangumpaybaomabibinginakaintirangmbricossuriinnobodyhumihingiparusahansalu-salolatersorrylibertymedievalmasayang-masayakasuutanlaranganumangat