Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

38 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

21. Stress can be a contributing factor to high blood pressure and should be managed effectively.

22. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

23. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

24. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

25. The doctor measured his blood pressure and diagnosed him with high blood pressure.

26. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

27. The king's court is the official gathering place for his advisors and high-ranking officials.

28. The laptop's hefty price tag reflected its powerful specifications and high-end features.

29. The medication helped to lower her high blood pressure and prevent complications.

30. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

31. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

32. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

33. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

34. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

35. The patient's family history of high blood pressure increased his risk of developing the condition.

36. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

37. Up above the world so high

38. Up above the world so high,

Random Sentences

1. Pinatawad din naman ni Ana ang mga ito.

2. Sila ay nagsisilbing modelo ng katapangan, katapatan, at pagmamahal sa bayan.

3. Taman Safari Indonesia di Bogor adalah tempat wisata yang menampilkan satwa liar dari berbagai belahan dunia.

4. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

5. Ang mga punong-kahoy ay kadalasang tinatanim bilang mga pampaganda sa mga pampublikong lugar tulad ng parke o plaza.

6. Kitang-kita sa muka ng ina ang pagtataka dahil may dalang basket na puno ng mga gulay at prutas.

7. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

8. En mi jardín, cultivo varias hierbas como el tomillo, la albahaca y el perejil.

9. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

10. Puwedeng hiramin mo ang aking laptop habang inaayos ang iyong sarili?

11. Dapat supilin ng pamahalaan ang mga kriminal na nagpapahirap sa mga inosenteng mamamayan.

12. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

13. Nagtaas na nang pamasahe ang bus.

14. Dahan-dahan niyang iniangat iyon.

15. Bunso si Bereti at paborito ng ama.

16. Las heridas superficiales pueden ser tratadas con agua y jabón.

17. Kumirot ang dibdib ko sa naisip.

18. Eine hohe Inflation kann zu einem Anstieg der Sozialausgaben führen.

19. I forgot my phone at home and then it started raining. That just added insult to injury.

20. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

21. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

22. Es importante reconocer los derechos y la dignidad de todas las personas, incluidas las personas pobres.

23. Iba ang landas na kaniyang tinahak.

24. Sana, binigyan mo siya ng bulaklak.

25. Nagtapos sya sa unibersidad ng Pilipinas.

26. Sa pagguhit, mahalaga ang pagpili ng tamang kasangkapan tulad ng lapis, papel, at krayola.

27. Ang bayanihan ay nagbibigay inspirasyon sa aming mga kabataan na maging aktibo at maging bahagi ng komunidad.

28. El nacimiento de un bebé trae consigo la alegría de ver crecer y desarrollarse a un ser humano.

29. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

30. La realidad es que a veces no podemos controlar lo que sucede.

31. Nagtaka ang bata sapagkat walang nangyari sa babae; sa halip nakangiti nitong ibinigay ang prutas sa bata na siya namang tinikman din ang bunga.

32. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

33. Nakikihukay siya ng mga halamang ugat at namumulot ng tirang pagkain.

34. Nagdala siya ng isang bigkis ng kahoy.

35. Pagtataka ko kung bakit hindi mo pa rin napapansin ang aking mga ginagawa para sa iyo.

36. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

37. Lumingon ang bata sa kanyang paligid, inisa-isa ang mga mukhang nakatunghay sa kanya

38. Sa Manila Hotel ka titigil, hindi ba?

39. Kapag wala akong iniisip na problema, ako'y nakakaranas ng isang matiwasay na pagkakasundo sa aking sarili.

40. The news might be biased, so take it with a grain of salt and do your own research.

41. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

42. Ang salarin ay gumamit ng pekeng pangalan upang makaiwas sa pagkakakilanlan.

43. Gamitin ang pangungusap ayon sa sinabi ng guro.

44. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

45. Gaano ka kadalas uminom ng bitamina?

46. Kikita nga kayo rito sa palengke!

47. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

48. Palibhasa ay mahilig siyang magbasa, kaya marami siyang nalalaman sa iba't-ibang paksa.

49. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

50. Ang mahal ng bili nya sa cellphone.

Similar Words

High-definitionhighest

Recent Searches

highstevemagbubungacommercialrestaurantromanticismoniyaplatformitsurajolibeekasamahanpinagkiskismasaganangbrasoplaguedkasiniyanhahatolibotobasketnuevoipinatawagbusilakdegreesyelonenapag-uwiunosdumatinglatestcompanyalisrosananahimikpunong-punomakahiramsumakayisareserveshinukaynagandahannahigakapataganwinsmakausapgasolinalayuninharapmalulungkotdeterminasyonsagingkarapatanmahuhusaycurrentborgeremagdamagbukassumuotmagbigaypangnangbilissobramatabababaeromaramipatiattentionpaksapaglalayagtoribiokaratulangmanahimikkailanmanbarongprimerpinagtabuyanpayapangtumigilcontinuespinasokevnedinmatandangbesidesnagliliwanagkesoadditionally,bagyotechniquesdontcenterbalediktoryansalahinagud-hagodperpektingrememberediilanpulismahabaahhbahay-bahayanwouldfurysarongsisipainmodernkinatatakutanbless1954klasengnagsilabasantickettagtuyotallowedbuhaydaratingvitaloutpoststreamingmumuntingpeksmantirahanabahanggangyumabongnagpalipatpocamaya-mayabungaotrosonsensiblesamepersonbilermapa,maagapanmalakipakpakwasteenergisourcesresponsiblekasintahanlearningestablishedblogartiststerminonutrientsnavigationpagbubuhatantilarawamountsignaldirectareplacedbilingkanluransisentapostlokohinimposibletypespoonwasakpicturenailigtasconsiderpinamangungudngodbantulotnerosakitpinunitwakassumusunodbilhinubodngitikatandaanpondoaeroplanes-allnag-aralsabihingmagdaanginangnitongmadungislistahanhinahangaanskirtbinigyangmagkasinggandaliligawanyumabangreturnedhikingsela