Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

2. Masyadong ganid sa salapi ang taong iyon.

3. Tak ada rotan, akar pun jadi.

4. Baro't saya ang isusuot ni Lily.

5. Ang taong maramot ay madalas hindi sinasamahan ng iba.

6. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

7. Kumusta ang nilagang baka mo?

8. Ang ibon ay mabilis na lumipad palayo matapos itong pakawalan mula sa hawla.

9. Kevin Durant is a prolific scorer and has won multiple scoring titles.

10. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

11. Bien hecho.

12. Sa bawat pagkakataon na pinagmamalupitan ako, lumalaki ang poot sa aking puso.

13. Galing sa brainly ang isinagot ko sa asignatura.

14. Ang mga halaman ay dapat na pinapakain sa regular na may compost o fertilizer upang matiyak na sila ay may sapat na nutrients para sa paglaki

15. He has visited his grandparents twice this year.

16. Pinag-aaralan ng mga mag-aaral ang talambuhay ni Ramon Magsaysay bilang isang "Man of the Masses."

17. Está claro que necesitamos más tiempo para completar el proyecto.

18. Es importante que los gobiernos tomen medidas para ayudar a las personas pobres.

19. The momentum of the economy slowed down due to a global recession.

20. I am not listening to music right now.

21. Ate, gusto ko sanang mag-isa.. ok lang ba?

22. Iniintay ka ata nila.

23. Nareklamo ko na ho ito pero wala hong sagot.

24. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

25. O-order na ako. sabi ko sa kanya.

26. Nakatanggap ako ng email sa dakong huli ng gabi mula sa aking boss.

27. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

28. Oo naman! Idol ko si spongebob eh.

29. Masaya ang buhay kapag mayroong kaulayaw na handang tumulong sa iyo.

30. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

31. Stop crying and pull yourself together, we have work to do.

32. Paano ako pupunta sa Intramuros?

33. Ako si Rodona ang diwata ng budok na ito.

34. Mi amigo me enseñó a tocar la guitarra y ahora podemos tocar juntos.

35. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

36. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

37. Papunta siya sa Davao bukas ng tanghali.

38. Malapit na naman ang bagong taon.

39. Hinde naman ako galit eh.

40. Emphasis can be used to create a sense of drama or suspense.

41. Gusto kong magbasa ng libro, datapwat hindi ko alam kung anong libro ang pipiliin ko.

42. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang matuto at magpamalas ng kanilang kakayahan.

43. Pigain hanggang sa mawala ang pait

44. The park has a variety of trails, suitable for different levels of hikers.

45. Los adolescentes son especialmente vulnerables al uso de drogas debido a la presión social y la curiosidad.

46. At pagkauwiy humiga nang humiga at paulit-ulit na tumingin sa kawalan.

47. Mahirap hanapin ang katotohanan sa kaibuturan ng kaso.

48. Sa may ilalim, nakuha niya ang kulay-lumot niyang kamiseta.

49. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

50. Ang sakit niya ang nakapanghihina sa kanya.

Similar Words

High-definitionhighest

Recent Searches

facilitatingoverviewhighmapapaferrerelectronicmatutopinapakiramdamanmatesalamigmastermassesmarkedmarielmuchdumaramirelevantroughimpitcreationsquatternariningrawmarianmaputimaitimmaisipmainitmahiyamahabamagingmaatimlumakilumagolorenana-fundlookedlitsonlinggolindollilikolibongletternaglokolegacylayuanlatestsahiglasongnangangalirangsawapinalalayasmabagaltulisanbayannagplayatinpaladipinagbilingpinaggagagawaaustraliapebreromaalwangvasquespatingkasitengakatandaanboracaynausalabonofrakaringpinalakinglarryeskuwelahannalulungkotpagka-maktolrevolucionadomagpa-pictureginugunitaenfermedades,ngaamintinikkasalananthroathoykasoycubiclehelpedtugonmaliitnaaliselenahimayinlinggongtagaytayngumiwinakakainhayaangnakakamituugod-ugodmensahenangangalitkarunungannapapasayatatlumpungpaglalaitaanhincultivanahawakannagsunurangamesglobalisasyonkaaya-ayangmakikiraantravelerpagkaraatuloypulangnanlalamigmagkamalititanegro-slavestumutubopronounpagdukwangpaglisanisasabadpinapasayamatapobrengayanintramurosnaglokohanskyldes,intindihinvidenskabmanilbihanmateryalestv-showsdesisyonannagdadasalbalahibokinalalagyannabasakargahanpinapakinggantungopalasyokapataganmarketing:therapeuticsbayadsasakaycultivationnationalkindergartenincitamenterpaliparinmadadalanobodysumasayawpasahepaalamtsonggogagamithinalungkatrespektivetusongkusinaarturopagpalitkastilahinagispinisilkontratirangmanalomusicalbihiraeleksyonpinilitlabahincandidateslittledalawindisciplinunosampliasongssiguronuhmadalasculturegrammarnagtatanongsusilaptopbumalik