Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Oh! What a coincidence, dito ka pala nagtatrabaho?

2. Wala ho akong kinukuha sa inyong pitaka.

3. Børn har brug for at lære om kulturelle forskelle og respekt for mangfoldighed.

4. Hindi ako sang-ayon sa mga pahayag ng ilang mga personalidad sa social media.

5. Hindi ko na kayang itago ito - may gusto ako sa iyo.

6. Magaling sumayaw ng Tinikling si Gabe.

7. Ngunit may isang hayop ang hindi niya malaman kung saan siya papanig.

8. Puwede ho ba akong kumain ng baka at baboy?

9. This can generate passive income for you, but it does require some capital to get started

10. ¿Cuántos años tienes?

11. Siguro nga isa lang akong rebound.

12. Nationalism can be a source of conflict between different groups within a nation-state.

13. Mayroong hinahabol na magnanakaw sa kalsada na inaabangan ng mga pulis.

14. Sa dakong huli, nakita ko ang kasalukuyang sitwasyon ng aking negosyo.

15. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

16. The waveform displayed on an oscilloscope can provide valuable information about signal amplitude, frequency, and distortion.

17. Nagitla ako nang biglang umalingawngaw ang malalakas na putok ng paputok.

18. La vieillesse est une étape de la vie où l'on atteint un âge avancé.

19. Bakit ganyan buhok mo?

20. Ang tubig-ulan ay maaaring magdulot ng pagpapakalma at kapanatagan sa mga tao dahil sa tunog ng ulan at sariwang hangin.

21. Mathematics provides a systematic and logical approach to problem-solving.

22. She is not playing with her pet dog at the moment.

23. Isa sa mga paboritong aliwan ng Pinoy ay ang panonood ng teleserye.

24. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

25. Sa mga hayop, ang hudyat ay maaaring gamitin sa pakikipag-ugnayan, tulad ng pagpapakita ng kilos ng buntot o ng mata.

26. Los niños son propensos a sufrir de tos debido a infecciones respiratorias comunes, como el resfriado común y la gripe.

27.

28. Anong karangalan ang ibinigay sa kanya?

29. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

30. The stock market is a platform for buying and selling shares of publicly traded companies.

31. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

32. The project gained momentum after the team received funding.

33. This can include reading other books on the same topic, interviewing experts, or gathering data

34. There were a lot of flowers in the garden, creating a beautiful display of colors.

35. Marami ang pumupunta sa Boracay tuwing

36. Las hojas de mi planta de tomate se ven amarillentas y enfermas.

37. Kapitbahay ni Armael si Juang malilimutin.

38. La música puede ser una forma de protesta y expresión de descontento.

39.

40. Ang albularyo ang tumulong sa pamilya para maalis ang sumpa sa kanilang lupa.

41. Don't cry over spilt milk

42. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

43. Napagod siya dahil magdamagan ang trabaho.

44. Ang pulis ay nakabalik na sa outpost at sa isang ospital na tumatawag.

45. Ano ho ba ang masarap na putahe ninyo?

46. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

47. Omelettes can be seasoned with salt, pepper, and other spices according to taste.

48. Isasama ko ang aking mga kapatid sa pamanhikan.

49. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

50. I forgot your birthday, but here's a card anyway. Better late than never, right?

Similar Words

High-definitionhighest

Recent Searches

imagingfatalareastandhighpinilingtextocadenasutilmeanlayout,interpretingcomputerusingsamedecreasewindowableaffectrepresentativewithoutdigitalevenrelevantnotebooknariningtermremotekankinayaenfermedadeslendingginawaumiiyakkabundukanparangadventtilaeffectsshouldsigurobuenababayarantumayotrabajarsaadpaglayasformstagsibolnaglipanangnapanoodproductsnapilitangcancerbranchikinakagalittagakginangpagodlabaslandlineadgangnapuyattungkodcualquiertumatakboundeniableisasagotmaibabaliklilypopularriyanwashingtonartswordsella1920snagpapasasavideos,maglalakadmakakatakasmagsalitanakapamintanagayundinnag-oorasyondoble-kararevolutionerettreatsmagpagalingpaghihingalonakadapaestudyantetumahimikvirksomhederpaghangamagdoorbellmedikalpambatangexhaustionunattendednangahaskatuwaanemocionantenagmadalingkamakailanadanaghihirapyumabangyouthkaklasekuryentemangahaspagkuwanmaulinigannecesarionaglahopakukuluanmakaiponpictureskaninohouseholdmangyaritinahakmagamottumikimmagdaraosmatutulogginawangumagangpapayapagmasdanbulalasiikutanumangatgawaingempresasnakauwidumalonayonumabotpauwicaraballoadvertisingvelfungerendedialledlunasnagsimulariegahabitsinanguntimelydiyospondoanakahitmimosakombinationkambingbaryokutodnamkababayanasawabeginningssikohomeszoosumakaydibadagatlumilingonginaganoonlinawmarumiplacenuonusapoloprimerbroadcastorderineducativasbarocupidforskelligelibrokakaindatipollutionmarsogamesencounterfireworksblueelectionsitaknapapatungofuryguiltydark