Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Los alergenos comunes, como el polen y el polvo, pueden causar tos en personas sensibles a ellos.

2. At habang itinatapat nito ang balde sa gripo, muli niyang nakita na nginingisihan siya nito.

3. Natatanaw na niya ngayon ang gripo.

4. The mission was labeled as risky, but the team decided to proceed.

5. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

6. Emphasis can be used to create rhythm and cadence in language.

7. Kain na tayo. yaya ni Maico sa amin.

8. Ang presyo ng gulay sa palengke ay mababa ngayong linggo.

9. Medarbejdere kan arbejde i forskellige områder som finans, teknologi, uddannelse, etc.

10. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

11. Sa panahon ngayon, napakahalaga ng mga taong bukas palad dahil sila ang nagbibigay ng pag-asa sa mga taong nangangailangan.

12. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

13. Sang-ayon ako sa kagustuhan mo na magpatuloy sa iyong pag-aaral.

14. "Let sleeping dogs lie."

15. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

16. Magtatapos ako ng aking thesis sa buwan na ito, datapwat kailangan kong maglaan ng mas maraming oras para dito.

17. Terima kasih. - Thank you.

18. Les banques jouent un rôle clé dans la gestion de l'argent.

19. Jeg har opnået stor erfaring gennem mit arbejde med at lede projekter.

20. Selvstændige medarbejdere arbejder ofte på egen hånd.

21. The website's content is engaging and informative, making it a great resource for users.

22. Nag-alok ng tulong ang guro sa amin upang matugunan ang mga hamon ng bagong kurikulum.

23. They have been playing board games all evening.

24. Leonardo da Vinci nació en Italia en el año 1452.

25. Sa aming eskwelahan, ang mga mag-aaral ay nagtatanim ng mga gulay sa school garden.

26. Ang tagumpay ng aking mga estudyante ay siyang ikinagagalak ng aking puso.

27. Sige, tatawag na lang ako mamaya pag pauwi na ko..

28. Ang mga bayani ay nagbibigay inspirasyon sa mga kabataan upang maging mabuting mamamayan.

29. Di ko inakalang sisikat ka.

30. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

31. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

32. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

33. La letra de una canción puede tener un gran impacto en la audiencia.

34. Kainis ka talaga! sabi ko sabay hampas sa braso niya.

35. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

36. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

37. El agua potable es fundamental para mantenernos hidratados y saludables.

38. Magmula noon nakilala na sa Palawan ang pating.

39. Ako ay nagtatanim ng mga puno ng niyog sa aming lupang sakahan.

40. I love you so much.

41. Ang laki ng kalabaw ni Mang Jose.

42. Nagpatingin ang bata sa albularyo matapos siyang makagat ng aso.

43. Sa pag-aaral, mas nagiging matiwasay ako kapag maayos ang aking mga talaarawan.

44. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

45. Nagmadali kaming maglakad papalapit kay Athena at Lucas

46. Ano ho ang tingin niyo sa condo na ito?

47. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

48. Hindi dapat basta-basta magpautang ng pera dahil ito ay maaaring magdulot ng problema sa kahuli-hulihan.

49. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

50. Her charitable spirit was evident in the way she helped her neighbors during tough times.

Similar Words

High-definitionhighest

Recent Searches

authorferrerhigheveningschedulevariouspdaproducirprofessionalmatabawednesdaykapangyarihannagpalutogawinggawininangkinauupuangciteatensyongnagdadasalk-dramaperonakaakyatmahigitmarahasjuicenegativekaysapaladcnicowaysmahiwagangrecentelectshiftapphinigitbingopaskonghinogkasoaumentaralaysumasakitginaganoonfulfillingsundaevillagenasasakupanpaglalaitalikabukinpagsumamonagtuturooktubremagkikitanagtitindanagpapaigibeskwelahanpupuntahannaibibigaypumapaligiddekorasyonrevolutioneretbinibiyayaanfollowing,naguguluhangcultivaonline,paanonatanongharapanhouseholdmamahalintaga-ochandotinataluntonnaghilamossagutinpilipinopangyayaringbuwalnakataasmagpapigilumiimikpagkasabimanatilitumiranagkasakittitamahinangpagdudugokonsyertomenshistoriakagabinaabotminerviepagmasdanproducererbintanapinipilitnitongkapalkatolikoganyannakabiladlabahinmarinigsongslugawibabawhinahaplospersonjagiyabalinganbobotorepublicancompletamentefederalpulongpakaininpagpasokmaistoypamimilhingbateryaenergipamamahingamasaraptsssmaisipalakkendimatayogpiecesproductionomghidingokayeffektivgabingmournedmagsasakapalayiniinomtransmitidasipanlinisearnharingahitmedievalumingitmalapadsaansukatwordaywaninalokumiilingfonocomefansfridaysumindilatestpshpitakazoomvivalcdmakamitrelativelydarkeyepracticadocheftabipinunitratecommunicationsbusdrewsameincludegapkasingsalapielectedjohnreleasedcreationhimigasosubalitbagomedya-agwaginugunitaiboneconomicmakapangyarihangaanhin