Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. La boda de mi amigo fue una celebración inolvidable.

2. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

3. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

4. Ang mga bayani noon ay nangahas na ipaglaban ang kalayaan kahit na kapalit nito ang kanilang buhay.

5. The project gained momentum after the team received funding.

6. Ang kotseng nasira ay kotse ni Jack.

7. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

8. Natigilan siya. Tila nag-iisip kung anong gagawin.

9. May nadama siyang ginhawa ngunit pansamantala lamang iyon.

10. Tiyak daw na bibili sila ng mga paninda niya.

11. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

12. The airport was busy, and therefore we had to arrive early to catch our flight.

13. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

14. Let's just hope na magwork out itong idea ni Memo.

15. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

16. Limitations can be viewed as opportunities for growth and personal development.

17. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

18. Ang masamang balita ay unti-unting naghatid ng kanyang damdamin palayo sa kasiyahan.

19. Sa bawat panaghoy ng mga ina, umaasa silang magkakaroon ng katarungan ang kanilang mga anak.

20. Magkano ang arkila kung isang linggo?

21. His administration pursued a more confrontational stance towards countries like China and Iran.

22. The stock market can be influenced by global events and news that impact multiple sectors and industries.

23. Tesla was founded by Elon Musk, JB Straubel, Martin Eberhard, Marc Tarpenning, and Ian Wright.

24. Ang guro ko sa Ingles ay nagturo sa amin ng iba't ibang uri ng pangungusap.

25. Nagsmile si Athena tapos nag bow sa kanila.

26. Ang pagdidilim ng aking paningin ay nagpahiwatig ng pagdating ng masamang panahon.

27. Haha! Bakit masama bang makidalo sa ball ng ibang school?

28. Jeg er i gang med at skynde mig at få alt færdigt til mødet. (I'm in a hurry to finish everything for the meeting.)

29. Internal Audit po. simpleng sagot ko.

30. Nagpasensiya na lang si Aling Rosa, napagsilbihan naman siya kahit paano ng anak.

31. Bagama't mabait ay mailap ang hayop na ito dahil sa hiya.

32. Sa pagtatapos ng araw, nakakapagbigay ng kakaibang kalma ang pakikinig sa musika habang nag-iisa.

33. Ano na nga ho ang pamagat ng palabas ninyo?

34. My mom always bakes me a cake for my birthday.

35. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

36. Nagandahan ako sa pagtatapos ng libro.

37. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

38. Emphasis is an important component of artistic expression, such as in poetry and music.

39. Kainis ka talaga! sabi ko sabay hampas sa braso niya.

40. She burned bridges with her friends by spreading gossip about them.

41. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

42. All these years, I have been overcoming challenges and obstacles to reach my goals.

43. Tinanong ko ang kapitbahay kung puwede kong hiramin ang kanilang lawnmower.

44. Bitbit ng isang kamay ang isang pangnang sisidlan ng kanyang pamimilhing uulamin.

45. Ano ho ang gusto ninyong bilhin?

46. El nacimiento es el momento en que un bebé sale del útero de la madre.

47. Good things come to those who wait.

48. Bakit wala ka bang bestfriend?

49. Di na natuto.

50. All these years, I have been striving to live a life of purpose and meaning.

Similar Words

High-definitionhighest

Recent Searches

farhighdollarilawpinagtagpomagkikitasponsorships,lumalakigayunmannagpakitamanamis-namiskadalagahangmaintindihankumirotincluirkulungannangangakomedicalkayabanganochandomakasalanangcompositoreskahitmariajuananadeterminasyonahasayonunahindisenyongnapapasayanakalipasjobsnakakasamatravelernamuhaytemperaturainuulampamagatestasyonmagdaraostumikimculturesumangatsignalhagdanangawainnapansinbulalasmatutulogtanyagalanganlalargakadaratingkuligligpapalapitumupocurtainstenidoretirarumulanrequierengatolbihiramedievalkabibitelangplacecivilizationsweetlutospentsumigawkasohappenedlinawabangangardenmagturosyncsalapimethodsthirdallowsworkingtermratecomunesataquesateconcernsdaangyanbranchesintroducepetsaknowsmalinissinongsparkatentohamakpopcornmakapaibabawmaghaponkasangkapantindahansukatbringulampinuntahannagpatimplatreatsglobalisasyonxixcrazyalagaibinubulongbukakanapakatalinotinaasaneroplanonobodykumakainkakilalasinehankumembut-kembotnagtatanongpaghahabinapadaanmagdaanparoroonasmilemasipaghinabolpaskohomeislanakatirapalengkegurotransitmagkaharapnagsidalomananaogimporpanindangbalangmangealamidnag-poutklimaformaspacestrategypayiguhitkaraokegumisingbinawiannapadpadnagwikangmatutongmaibatools,natingalabrieftryghedprimercontestfeedback,computertutorialsstopconsidertechnologiesnotebookelectedmabigyankaklasecoalkelaniconsplasakumatokmaidnapapatungomagkaparehonamulatmagkakagustonalalaglagnagpepekenakakapamasyalpinakamaartengfollowing,turismobloggers,miramaihaharap