Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

2. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

3. Hindi ito nasasaktan.

4. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

5. Coffee is a popular beverage consumed by millions of people worldwide.

6. Ito rin ang parusang ipinataw ng di binyagang datu sa paring Katoliko.

7. Dali na, ako naman magbabayad eh.

8. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

9. Bihira na siyang ngumiti.

10. Mi mejor amigo siempre está ahí para mí en los buenos y malos momentos.

11. Haha! Who would care? I'm hiding behind my mask.

12. Ang kahusayan ng isang guro ay dapat na itinuring at kilalanin ng mga mag-aaral.

13. The wedding ceremony is often followed by a honeymoon.

14. Noon di'y nangalaglag ang lahat ng mga bunga ng punong-kahoy at natabunan ang katawan ni Sangkalan.

15. Durante las vacaciones, me gusta relajarme en la playa.

16. Når man bliver kvinde, kan man opleve en række fysiske og følelsesmæssige forandringer.

17. Bigla siyang bumaligtad.

18. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

19. Hindi sadyang nasaktan siya nang malaman niyang iniwan siya ng kanyang kasintahan.

20. Narinig ng mga diyosa ang kayabangan ng bata.

21. The use of emphasis is influenced by cultural and social norms.

22. El acceso al agua potable es un derecho humano fundamental.

23. A successful marriage often requires open communication and mutual respect between a husband and wife.

24. Hiramin ko ang iyong bike para sumali sa cycling event sa Sabado.

25. Saan-saan kayo lumibot sa Amerika?

26. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

27. Pedro at Juan ang mga pangalan namin.

28. Hindi naman yan iniisip eh! Pinapakiramdaman!

29. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

30. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

31. Nais sanang magbago ng isip si Magda, ngunit nanaig ang kanyang pagkagusto kay Damaso.

32. Mabilis manakbo ang aso ni Lito.

33. Magandang umaga po, mga mahal na manonood.

34. Masakit para sa isang ina ang sinapit ng kanyang anak ngunit masaya sa kaloobang tinanggap iyon ni Busyang.

35. Diyos ko, ano po itong nangyayari sa aming anak?

36. They have been studying math for months.

37. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

38. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

39. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

40. Ang ganda na nang bagong Manila zoo.

41. Kahit malilimutin si Mia, sinisikap niyang ayusin ang kanyang schedule para maging maayos ang kanyang araw.

42. Hindi ko alam kung paano ko sasabihin, pero crush kita.

43. Nakita niyang lumalakad palayo ang kaibigan, na tila may tinatago.

44. Einstein's work also helped to establish the field of quantum mechanics.

45. Masyadong ganid sa salapi ang taong iyon.

46. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

47. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

48. Sa Manila Hotel ka titigil, hindi ba?

49. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

50. Las plantas carnívoras son capaces de atrapar y digerir insectos u otros pequeños animales para obtener nutrientes adicionales.

Similar Words

High-definitionhighest

Recent Searches

highnagcurvenagpakunotsalenagpapaigibedwinnangapatdanmaliwanagnanoodbintanataoskakayanangbantulotbunutanpaladbefolkningenmalikotbaryolenguajelipadnag-uwicomputere,1920ssonidopagodadangbigoteipagamotbansamaluwanginformationtransitnutrientesknightstockstrajealaslagunatungkolkamustakumbentogayundinpakikipagtagpotssskinatatalungkuangdistansyamakalaglag-pantypanikinakayukoliv,magbayadnagtuturosasayawinmagpapabunotnakagalawkalaunanyumabongnagpalutona-suwayminamahalkare-karetahananhampaslupapamumunonapatulalainaabutannakadapalinggongmananaloinvestsharmainepoongkaninoenviaraga-agataonanaloipinatawagilalagaychefkendtnananalomagkasamahinalungkatsinghaldistancepanonoodikinagalitnagngangalangpinalalayasregulering,pagbebentamakaiponhinihintaypaosnahahalinhanibinaonumiwasinhaletsonggopasasalamatsangatienencombatirlas,inilabasnapamartianniyanarturonamilipittelephonenaawaisinalaysaynochenatulakbagocashangkopomfattendesayamatangumpayligaligpinagkasundolalakekuwebaartepaldaarkilarestawrandyipsawaparkingpogimatulissumasakitlarongnogensindelingidbarotoreteblazingdipangsuotcassandrabotantesenateperasumaboglegendsbinibinifeedback,partyresignationanimoybranch1940nagpuntahanfacebookmapaikotknow-howasinbookchavitotrassubjectspeechesmanonoodnakakagalamadilimbadnaroonpromotingyearofferinalalayanmacadamiaimaginationpookdevelopmentcontinuedcomunicarseestablishedincreasedwhytrueipagtimplapag-uwinakapagsalitataga-hiroshimanakatagomagsusuotpinapasayabulongturoncandidatesnatitirangdisciplincapitalbumotoiskedyul