Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Kahit ang diyosang si Venus ay walang panama sa kaniya.

2. Busy sa paglalaba si Aling Maria.

3. Mahigpit na binabantayan ng mga otoridad ang mga kilalang salarin sa lungsod.

4. I know we're behind schedule, but let's not cut corners on safety.

5. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

6. Les personnes âgées peuvent être victimes d'abus ou de négligence de la part de leur entourage.

7. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

8. Maaliwalas ang panahon kaya itinuloy namin ang piknik.

9. Ang mga akda ni Rizal tulad ng "Noli Me Tangere" at "El Filibusterismo" ay naglalaman ng mga kritisismo sa pamamahala ng Espanya at nag-udyok sa rebolusyonaryong diwa sa Pilipinas.

10. Ako ay sobrang gutom, bagkus ako ay mag-aantay na lang ng hapunan mamaya.

11. Mapapa sana-all ka na lang.

12. Ano ang nasa tapat ng ospital?

13. Ayaw niyang kumampi sa matatalo kung kaya't ang ginawa niya ay nagmasid-masid muna ito sa di kalayuan at pinanood ang nagaganap na labanan.

14. The acquired assets will improve the company's financial performance.

15. Hindi ko maaaring pabayaan ang aking mga agam-agam dahil ito ay maaaring magdulot ng panganib sa aking buhay.

16. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

17. Sa ngayon, makikita pa rin ang kahusayan ng mga gagamba sa paghahabi ng kanilang mga bahay.

18. Pinagpalaluan ng mga empleyado ang kanilang manager dahil sa kanyang mahusay na pamumuno.

19. Umalis siya papuntang Cebu kahapon ng hapon.

20. Kailangan ng mas magandang oportunidad sa trabaho at edukasyon para sa sektor ng anak-pawis.

21. Many people experience stress or burnout from overworking or job dissatisfaction.

22. Eine Inflation kann auch durch den Anstieg der Rohstoffpreise verursacht werden.

23. Kung hindi siya maramot, baka mas marami ang natulungan niya.

24. Saan itinatag ang La Liga Filipina?

25. Robert Downey Jr. gained worldwide recognition for his portrayal of Iron Man in the Marvel Cinematic Universe.

26. Sa balkonahe ng kanyang bahay sa Kawit, idineklara ang kalayaan ng Pilipinas.

27. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

28. Walang matigas na tinapay sa gutom na tao.

29. Nous avons choisi une chanson spéciale pour notre première danse.

30. Awitan mo ang bata para makatulog siya.

31. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

32. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

33. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

34. Nakapag-simula ako ng halinghing exercise nang hindi inaasahan na makakatulong ito sa aking anxiety.

35. Sa di-kawasa ay dumating ang malungkot na sandali.

36. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

37. Ano ho ang ginawa ng mga babae?

38. Para sa kaibigan niyang si Angela

39. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

40. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

41. Hindi ko lang sya pinansin at iniling lang ulit ulo ko.

42. Maaaring magdulot ng pangmatagalang epekto sa kalusugan at kaligtasan ng mga tao ang digmaan.

43. Kalaro ni Pedro sa tennis si Jose.

44. Nakasuot siya ng maluwag na damit para hindi lumala ang bungang-araw.

45. Ako ay nagtatanim ng mga halaman sa aking bakuran.

46. Pumasok ang mga estudyante sa klase nang limahan.

47. Buti na lang medyo nagiislow down na yung heart rate ko.

48. Nakuhang muli ang gong at nagkaroon pa ng punong may matamis na bungang hugis kampana ang mga taong-bayan.

49. Ang laki nang mga gusali sa maynila!

50. Marahan niyang inalis sa pagkakakawit ang mga balde.

Similar Words

High-definitionhighest

Recent Searches

enforcinghighmag-inabansanariningprotestawindowaraynatulogtatlumpungmakikipag-duetopaghugosnagtatampobibisitamanggagalingginoonglandslidebihiratungohotelnenakamoteprinsipengbefolkningen,maglalaronakatulogbutchtiktok,bumabahamalimitsalbahepinuntahanpagkainisbabasahintinutopnaiilaganagadenternahintakutantinaykunintumahanbeautymangyarijobsnagsunuranmedyomaasahannaulinigankatagalkumirotnakakamitpinapataposlumakaskinainbabaevedvarendetumunognakatindigre-reviewriyanoverallindianagbabalafysik,jobginawang4thdaramdaminisinusuotdolyarpinauwipaostumigilkakayananpasyentekumapitkaliwasignalmahalmaintindihanngitisalaminspaghettimansanasiniirogoperativoskirbypagpanhikgawingampliaathenanararapatmagamotpagkatakotmahabolbuung-buounderholdermumuntingbuwayacountriesnegosyantepisokasaysayangardendipangbusyangbarnescryptocurrency:votesyepnatagalannewmalabolinecesmakisuyoestablishedmakesformsprogrammingika-50relylilimmataimpitnilalangmensajesmaaamonginirapannakagalawsaranggolapinakamatapatnagtrabahonanghihinanagre-reviewagricultoresspiritualabundanteikinabubuhaynakapangasawamakalingjerrynasasabihantiniradorpagkuwamagagandangnaguguluhangiba-ibangculturalcarspangyayarisabadongbatoks-sorrykalayuankahariannapasigawmakalipasliv,napakasipaghinagud-hagodmisusednapahintonag-uwimagpahabapagsagotawtoritadonglaterartistkanikanilanglalakadpambatangbagamamaingatmakaraancashnakatayobaguiobinuksanstorysanggoliniuwitelebisyonlumusobumiyakasignaturaipinatawagvillagemauliniganmagalitporkapwatagumpaypropesornabigkastumindigpakistansinapaklangit