Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Muli niyang tiningnan ang nakabulagtang si Ogor.

2. To: Beast Yung friend kong si Mica.

3. Masayang-masayang napanood ng Buto ng Kasoy ang sayawan, kantahan, at pagkakatuwaan ng mga hayop at halaman.

4. Starting a business during an economic downturn is often seen as risky.

5. Muchas ciudades tienen festivales de música que atraen a personas de todo el mundo.

6. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

7. Nakatanggap ako ng inspirasyon sa mga kanta ng Bukas Palad sa panahon ng pandemya.

8. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

9. Tumagal ng tatlong oras ang kanyang operasyon.

10. Aling hiwa ng baboy ang gusto mo?

11. Don't cry over spilt milk

12. Les sciences de la Terre étudient la composition et les processus de la Terre.

13. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

14. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

15. Dahil kung anong ganda ng katawan ay siya namang pagkaimpakto ng mukha.

16. Ang Ibong Adarna ay nakapagbigay ng inspirasyon sa maraming manunulat at makata upang magsulat ng kanilang sariling mga obra.

17. He was warned not to burn bridges with his current company before accepting a new job offer.

18. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

19. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

20. Ang Sabado de Gloria ay tahimik

21. Kinagalitan si Bereti at pinauwi ngunit ayaw sumunod ng bata.

22. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

23. Kulay pula ang libro ni Juan.

24. Naaalala mo pa ba noong tayo pang dalawa.

25. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

26. Kumain kana ba?

27. Palibhasa'y walang kalaro, ang mga hayop na lang ang ginawang libangan nito.

28. May isa pang nagpapaigib sa kanya.

29. Magkano ang polo na binili ni Andy?

30. Taos puso silang humingi ng tawad.

31. Tangka na niyang pagbubuhatan ng kamay ang matanda nang biglang lumiwag ang damit ng matanda at nagbago ang kanyang anyo.

32. She is designing a new website.

33. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

34.

35. Sa tulong ng meditasyon, mas napalalim ang aking kamalayan sa aking sarili at emosyon.

36. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

37. Dapat pinakamasaya ang Sabadong ito sa lahat ng Sabado.

38. May tawad. Sisenta pesos na lang.

39. Ang huni ng mga Kuliglig at kokak ng mga Palaka ay sumasaliw sa awit ng mga Maya.

40. Omelettes are quick and easy to prepare, making them a convenient meal option.

41. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

42. Es común usar ropa abrigada, como abrigos, bufandas y guantes, en invierno.

43. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

44. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

45. Nang magkaharap ang mag-ama, ang kanyang ama ay hindi niya ito tinanggap

46. Las labradoras son perros muy versátiles y pueden adaptarse a una variedad de situaciones.

47. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

48. Agad niyang dinala ito kay Mang Sanas.

49. Ipinakita nya ang determinasyon sa larangan ng boxing.

50. Ano namang inasikaso mo sa probinsya?

Similar Words

High-definitionhighest

Recent Searches

highstrengthpinunitbuladaigdigstonehaminalislayasstyrerkitautomaticsmallsaglithahawatchingvehiclespaghakbangetsymakamitbayaranshipskyldesfeelingmalapitipaghugasharilookedayawinfectiousrepublicsommeriendapaulasumigawcoachingnakakalayomulti-billionbahagikinikilalangparingpasasalamatnagtatakangadobobalancesmaya-mayaina-absorvepapelpakikipaglabannagandahanmanirahandumilatkinalalagyanhindedefinitivomakatawametodisknasiramakasamamaglabanilangselatransiticonbubongpinilingworkdayprocessnutsaktibistasasamahanpamanhikanlumiwanagbuung-buoanyonatitirangmarurusingsikatsinampalbuslonilulonsinkpaskodulottuwangnakalimutannamumukod-tangipinagkaloobanpinakamahalagangsinonag-aalalangnagpapaniwalapaghuhugashumalopagkagisingestasyonika-12tumamaerapslaveinventadoplanning,rabbaspindlecampaignskinalimutansumimangotsellingpakelamerodaramdaminactualidadaplicacionesnangangakofestivalespagkatakotpagsusulithinanapnabigaynatigilankauntibayaniinspirationpakiramdamisinusuotiyamottumindigligaya11pmhumalikgasolinahanbrindarandyanaabsentmabaitpakisabibrasolalakejuanlayawthemtheiryou,dogsmininimizeartistsosakalalapitabangannatalongwereuniversitytravelertandangcompartentandautusanwestleyteunderholderrelodrayberkatabinglaborsumalabuwaldaanitinaliluisstrategynathanredpag-akyateveryfurtherpartboydownnuninteriorneedsnapasigawnapakaramingnakakapagpatibaynagbigaynag-aagawancableviewworkingdifferentaddingflashtutorialsresultanabahalamalinismakasahodmagisipmagigitingmadadalamabibingijeju