Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. He is not taking a walk in the park today.

2. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

3. Kami ay pabalik na diyan sa kaharian, pasensiya na sa masamang balita.

4. Les maladies chroniques telles que l'asthme, l'arthrite et le syndrome de fatigue chronique peuvent affecter la qualité de vie d'une personne.

5. Inalala nila ang mga aral na itinuro ng misyunero tungkol kay Kristo.

6. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

7. Si Jose Rizal ay isang pambansang bayani ng Pilipinas na ipinanganak noong ika-19 ng Hunyo, 1861 sa Calamba, Laguna.

8. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

9. Nag-iisa man siya, hindi siya nawawalan ng pag-asa.

10. Ang pagmamalabis sa paggamit ng mga plastik na bag ay nagdudulot ng environmental pollution.

11. Napakalaki talaga ng isla sa boracay.

12. Puwedeng dalhin ng kaibigan ko ang radyo.

13. Nous avons fait un discours lors de notre réception de mariage.

14. I love you so much.

15. Ang korupsiyon ay laganap sa gobyerno.

16. Påskeæg er en traditionel gave i påsken og er ofte fyldt med slik eller små gaver.

17. Maraming misteryo ang bumabalot sa kanilang lugar.

18. Sinuman sa kaharian ay walang makapagbigay ng lunas.

19. Pede bang itanong kung anong oras na?

20. Nasa tabing-dagat ako at nagitla ako nang biglang sumulpot ang isang malaking alon.

21. Joshua, kumusta ang pakiramdam mo?

22. They are cooking together in the kitchen.

23. Ayaw ko magtangkang magbiyahe nang walang mapa.

24. The rise of digital currencies and payment systems is changing the way people use and think about money.

25. Siya ay kilala sa kanyang magalang na pag-uugali kahit sa mga hindi niya kakilala.

26. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

27. Goodevening sir, may I take your order now?

28. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

29. Membangun hubungan yang mendalam dengan diri sendiri dan orang lain, serta merayakan momen-momen kecil, memberikan kebahagiaan yang tahan lama.

30. Naglabas ako ng malalim na himutok matapos kong matalo sa paligsahan.

31. Mabait sina Lito at kapatid niya.

32. Las escuelas también tienen la responsabilidad de asegurar un ambiente seguro para los estudiantes.

33. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

34. Nang magbago ang mga pangyayari at matanggap ko ang mga kaganapang hindi ko inaasahan, ang aking pagkabahala ay napawi.

35. Women make up roughly half of the world's population.

36. He bought a series of books by his favorite author, eagerly reading each one.

37. Yan ang totoo.

38. Hinawakan ko yung kamay niya.

39. Emphasis can be used to create a sense of drama or suspense.

40. Si Aguinaldo ay kinikilala bilang isa sa mga pinakamahalagang bayani ng Pilipinas.

41. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

42. Ang kanyang ngiti ay maaliwalas at nakakahawa.

43. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

44. Sige ako na ang isa pang sinungaling! Bwahahahahaha

45. Después de estudiar durante horas, necesito un descanso.

46. El arte puede ser interpretado de diferentes maneras por diferentes personas.

47. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

48. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

49. Samantala sa trabaho, patuloy siyang nagpapakasipag at nagsusumikap para sa kanyang pamilya.

50. Hindi nga ba't meron din daw siyang mga pakpak tulad nila.

Similar Words

High-definitionhighest

Recent Searches

bringgenecesadastagehighlabananhalagadataentryberkeleyaffectwithoutipinalitbituinthirdfallalasingmasterflashestablishedcontentnegativeenvironmentinteligentestechnologicalgenerationswouldmaintainadvertising,palabuy-laboyeksamenkanyaulingkilopowersrefkabutihankaninumanmaestronalakinaiyakpalengkedali-daliideyacubanagpalutopagbebentaevolucionadonatinrememberedmasarapumangattakesalatinbakasyonnaglabananalassarapogimaisaccederpasinghalkabibibipolarmagtatakamauuponanghahapdientrancetuluyanmagbantayisulatenviarinilistaganapinmaawaingoperativoslasanandiyanwinssentencebumabaharoonnatanggapinomstorycircleneronaroonpalakabalitaganyanmarunongmagkasintahanpinasalamatanlungkutinilabaslugarmalakaslumakihayaangearnanlilimostanghalikilongarmedjulietadicionalesmababangongpdaproducirmanggagalingnaglalambingauthoroffentligmapiniteskuwelatinangkamagsusunuranaanhinnaguguluhangpagpapautangpinakabatangsabadonghubad-baroalbularyomagpaliwanagtumawagcarskapangyarihansasayawinisinulatpinagalitanhinipan-hipantinatawagikinakagalitnakapapasongnangangahoykinikitananlilimahidpinapakiramdamangayundinnagpapaniwalaginugunitanagliliyabsalu-saloikinagagalakkinakitaannagtutulunganpinagsikapanbestfriendnagsabaypumitasmalapalasyonakakatandamaipagmamalakingumiinomunattendeddaramdaminpioneertiktok,nakatalungkopinuntahanmahuhusaytatagalnakadapanegro-slavespronouninilalabasinismagpagalingmaliksiminu-minutopinapasayanagpuyosmagbabagsikkisapmataedadexistpalantandaansakalinglolasurveysmahahawapatakbongpakistannakarinigpapalapitpropesornagyayangamuyinpinansinpinangaralanbayadkastilangisinusuotmagawatinuturohonesto