Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang sabi nya inaantay nya daw girlfriend nya! Ang sweet!

2. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

3. Nakita ko namang natawa yung tindera.

4. Sa loob ng sinehan, pinagmamasdan niya ang malalaking screen na nagpapalabas ng pelikula.

5. Microscopes are also used in materials science and engineering to study the microstructure of materials.

6. I caught my boyfriend staring at a picture of a pretty lady on his phone.

7. Dahil sa pagmamahalan ng dalawang pamilya, ang pamamamanhikan ay naging isang masayang pagtitipon.

8. Namnamin natin ang huling gabi ng ating paglalakbay.

9. Con paciencia y dedicación, se puede disfrutar de una deliciosa cosecha de maíz fresco

10. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

11. The use of emphasis is influenced by cultural and social norms.

12. Ipagtimpla mo ng kape ang bisita.

13. Mas romantic ang atmosphere sa dapit-hapon.

14. Sa Pilipinas, ang tag-ulan ay kadalasang nagsisimula mula Hunyo hanggang Nobyembre.

15. Presley's influence on American culture is undeniable

16. Ikinagagalak kong makita kang masaya sa bagong kabanata ng iyong buhay.

17. Nagpapadala ako ng mga kanta at mensahe sa aking nililigawan upang ipakita ang aking pagmamahal.

18. Bukas ang kupasing damit na giris, nakahantad ang laylay at tuyot na dibdib.

19. Nareklamo ko na ho ito pero wala hong sagot.

20. I am absolutely thrilled about my upcoming vacation.

21. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

22. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

23. Actions speak louder than words.

24. Mis amigos y yo estamos planeando un viaje a la playa para el verano.

25. Hala, gusto mo tissue? Sorry ah, hindi ko alam.

26. You may now kiss the bride. Sabi nung priest.

27. Tapos humarap sya sakin, Eh bakit ba nila ginawa yun?

28. Ano?! Diet?! Pero tatlong plato na yan ah.

29. Inakyat ng bata ang puno at tinikman ang bunga.

30. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

31. Ikinukwento niya ang mga masasayang alaala ng kanyang kabataan na ikinalulungkot niyang wala na.

32. Kapag mayroon kang kaulayaw, hindi ka mag-iisa sa mga pagsubok na iyong kinakaharap.

33. Nakonsiyensya ang dalaga sa sinabi ng diwata.

34. Beaucoup de gens sont obsédés par l'argent.

35. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

36. La pintura es una forma de expresión artística que ha existido desde tiempos antiguos.

37. Napangiti ang babae at kinuha ang pagkaing inabot ng bata.

38. Kasabay ko si Anna na magtanghalian sa canteen.

39. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

40. Nagkatinginan ang mag-ama.

41. Sinundo ko siya at pumunta kami sa ospital.

42. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

43. Bago matulog, naglalaba ako ng aking uniporme para sa darating na school week.

44. Gracias por ser honesto/a y decirme la verdad.

45. Uncertainty can create opportunities for growth and development.

46. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

47. Le livre que j'ai lu était très intéressant.

48. Kung may tiyaga, may nilaga.

49. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

50. The value of cryptocurrency can fluctuate rapidly due to market forces.

Similar Words

High-definitionhighest

Recent Searches

eksamsarongcertainherramientahighiikottawananmbricosmesangkutodintindihinartsmakasalanangbotonagpalalimcapitalcontentamendmentsnapapahintogitnaformatpagpasensyahantrycyclenalulungkotuugod-ugoddatamagkasing-edadpongclientsnagpipiknikmaihaharapactivityhidingipinaalambinibiyayaandreamsenchantedakinbridebagyothroughattorneymalumbaylayuanplatformssusunodupangfuenalugmokgoshdidpangulosumusulathydelyumaobateryainalagaanbanalsurgerymalungkotditodalawpatawarinpagkakataongbataynewspapersabibio-gas-developingginoongclosecovidbinatakaksidentemagisingrelativelybumugaambagnatayoengkantadasaan-saanmaghilamoskaugnayanatabiglaansinghalespadaadditionally,stoplightpropensomakeskamalayanrepresentedna-curiouslunasitutolpalagingitinaobgawainmaaarimangahasipagamotsikre,oponagtrabahoeconomicnatitirangsakupinbusiness:picsnakikitangsisentasubject,boyfriendpublicationsumangnagpapasasauulaminhikinggreatlyhelenamakikiraanlungsodumiibigdyipniendviderenationalradiosikatnegosyoyelotatawagyakapindalandanmadalingmisawidelyskyldes,siemprehopepalayanhampaslupagamestopaabotpasswordpagiisipattentionkartonparatingilihimputolabrilfionatiniklingnamumuladyanchavitartistaimportantesrosenapilisellingdumaramipacebilibidpamamahingasofapinaladstruggledmasarapnawalacadenangpuntasanggolsmilenag-iisipnakakakuharawiginitgitisaacpetertypescountlessmangangahoyeasysharingtoolfuncionesjoemanagerwriting,pilingengkantadangtanodnanaigimportanteflyvemaskinermababawsinunodmalasutla