Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

2. Matagumpay akong nakapag-alaga ng mga halaman kaya masayang-masaya ako ngayon.

3. Si tienes paciencia, las cosas buenas llegarán.

4.

5. Bumalik siya sa Pilipinas kasama ang suporta ng mga Amerikano noong 1898.

6. Sana makatulong ang na-fund raise natin.

7. Sa ganang iyo, may katuturan ba ang kanyang paliwanag sa harap ng hukom?

8. Gracias por creer en mí incluso cuando dudaba de mí mismo/a.

9. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

10. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

11. Limitations can be financial, such as a lack of resources to pursue education or travel.

12. Nag-alok ng tulong ang guro sa amin upang matugunan ang mga hamon ng bagong kurikulum.

13. Una mala conciencia puede llevarnos a tomar malas decisiones.

14. Hanggang sa dulo ng mundo.

15. Sa gitna ng katahimikan, nakita ko siyang tulala sa kanyang pag-iisip.

16. Nang malapit na siya, nagtatakbo ang dalaga at nawalang parang bula.

17. Naghanap siya gabi't araw.

18. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

19. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

20. Ang pagiging aware at vigilant sa paligid ay mahalaga upang maiwasan ang pagkalat ng droga sa lipunan.

21. Alam ko.. sinabi niya sa akin yun..

22. Kapag dapit-hapon, masarap mag-jogging dahil mas malamig na ang panahon.

23. They are not cooking together tonight.

24. Hindi ko maintindihan kung bakit kailangan ko pang magtiis sa ganitong sitwasyon.

25. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

26. Napakaganda ng mga pasyalan sa bansang Japan.

27. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

28. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

29. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

30. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

31. Sa dapit-hapon, masarap magbasa ng libro habang nakatambay sa balcony.

32. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

33. Limitations can be a result of fear or lack of confidence.

34. Ngunit marumi sila sa kanilang kapaligiran.

35. Madalas syang sumali sa poster making contest.

36. Hinahabol ko ang aking hiningang mahina dahil sa kalagitnaan ng marathon.

37. Sa gitna ng kagubatan, narinig ang hinagpis ng mga hayop na nawalan ng tirahan dahil sa pagtotroso.

38. Mayaman ang amo ni Lando.

39. Pakibigay ng respeto sa mga matatanda dahil sila ang unang nagtaguyod ng ating komunidad.

40. Matapos ang kanyang tagumpay, si Hidilyn Diaz ay tumanggap ng maraming parangal mula sa gobyerno at pribadong sektor.

41. Masyadong maaga ang alis ng bus.

42. Nous avons prévu une séance photo avec nos témoins après la cérémonie.

43. Sa kabila ng pagkamatay niya, ang diwa at mga ideya ni Jose Rizal ay nananatiling buhay at patuloy na nagbibigay-galang sa kasalukuyang henerasyon ng mga Pilipino.

44. Hindi dapat tayo sumuko sa agaw-buhay na laban sa kahirapan.

45. The uncertainty surrounding the new policy has caused confusion among the employees.

46. Patuloy pa rin ang paghalik ng butiki sa lupa tuwing dapit-hapon.

47. Ang pag-ulan ng mga bituin sa langit ay animo'y isang mahiwagang pagnanasa.

48. The sun sets in the evening.

49. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

50. A couple of photographs on the wall brought back memories of my childhood.

Similar Words

High-definitionhighest

Recent Searches

magselosna-curioushighasulsaktaninfectiouslabankruspagbigyankainwithoutmakidaloano-anochangedkasievolucionadonagwalisdinalawpaghingipagkaingdecreaseculpritresearchnooniligawanespadahapasinanototoongberkeleyrevolutionizedexpertisepropesorwindowchessfeedbackcubiclepaceiniuwiisubosusunduinjosietanganmini-helicoptertatawagsamahanmalakitumindigmayabangmagbubukidcitynaghilamosnaiilangeleksyonsequehojas,tulisanhimigissuespeterkaraniwangtawananibilipamilyaoktubrenagkapilatskirtkalaromarieldalinagbibigaybultu-bultongprogramming,masinopkuwartongmagkasamakaysarapkamukhanag-poutmanonoodgagandabinanggapublicationroleklaseagostopakinabanganpagtitiponwordsuedepagsahodpalibhasakagayanahigitannakaka-inpagkamanghakapatawaranumulanambisyosangkamalianmasaktanbinasaflyvemaskinerpatawarinnakilalatindapiyanomatikmanunabiyernesmayamangpromotebaryomaitimgrowthcornernapasukodapit-haponrememberedgapteleviewinggulatperladasalmakausapmulighedernagreplymaalogumibigkakatapostrackclientskasalukuyanbehalfhouseliigpinagmamalakitradisyonkatulongerhvervslivetcheckskitang-kitasingaporesadyangunibersidadpapaanopagpapasanlayasnaiyakmabigyanbalik-tanawgumuhitnationalmakukulaykumanansinumanimeldaputahespeedhuluikukumparapasangmapapamukacoalnasaannabiawangnagtatampobukadahiloncecommunicationnakayukopatayapatnapumaipantawid-gutomnasilawsabongmagpahabafar-reachingkagalakannaabotpebrerosantosnaglaromalagohurtigerefencingibiniliika-12katipunanbahabundokhinukaygraduallytamarawgracekambingctricasextra