Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Kucing di Indonesia adalah hewan yang sering menjadi teman dan sahabat bagi pemiliknya.

2. Some ailments are preventable through vaccinations, such as measles or polio.

3. Bilang paglilinaw, ang proyekto ay hindi kanselado kundi ipinagpaliban lamang.

4. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang maglingkod sa kanilang komunidad at sa ibang tao.

5. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

6. Kahit paano'y may alaala pa rin siya sa atin.

7. I don't like to make a big deal about my birthday.

8. Nakabili na sila ng bagong bahay.

9. Mahirap makipagkita ng basta-basta, kaya sana pwede ba kita makilala?

10. Ngunit may isang bata ang may bulate kaya lagi siyang walang gana.

11. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

12. At sa paglipas ng panahon, naging malakas na ang lalaki na nakilala nilang Damaso.

13. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

14. También trabajó como arquitecto y diseñó varias estructuras importantes en Italia.

15. El control de las porciones es importante para mantener una dieta saludable.

16. El accidente produjo un gran tráfico en la carretera principal.

17. Mapapa sana-all ka na lang.

18. Stuffed Toys, Mini-Helicopter, Walkie-Talkie, Crush Gear, Remote Controlled Cars, at higit sa lahat, ang Beyblade.

19. Pero pag harap ko, para akong nanigas sa kinatatayuan ko.

20. Naglalakad ako sa kalsada nang bigla akong napagod sa hatinggabi.

21. Einstein's work also helped to establish the field of quantum mechanics.

22. Sebagai bagian dari perayaan kelahiran, orang Indonesia sering mengadakan acara syukuran atau kenduri.

23. My favorite thing about birthdays is blowing out the candles.

24. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

25. Musk has been named one of the most influential people in the world by TIME magazine.

26. The festival showcases a variety of performers, from musicians to dancers.

27. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

28.

29. Aling lapis ang pinakamahaba?

30. Jacky! si Lana ng sagutin ko ang CP ko.

31. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

32. Nakasandig ang ulo sa tagpiang dingding.

33. A picture is worth 1000 words

34. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

35. Bilang paglilinaw, ang pagsusulit ay hindi bukas kundi sa susunod na linggo.

36. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

37. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

38. Les personnes ayant des antécédents de dépendance ou de problèmes de santé mentale peuvent être plus susceptibles de développer une dépendance au jeu.

39. Mahalagang mabigyan ng sapat na konsiderasyon ang mga isyu ng sektor ng anak-pawis sa pagpapasya ng mga polisiya ng pamahalaan.

40. Sa tuwing nakikita kita, nadarama ko na may gusto ako sa iyo.

41. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

42. En resumen, la música es una parte importante de la cultura española y ha sido una forma de expresión y conexión desde tiempos ancestrales

43. Twinkle, twinkle, little star,

44. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

45. Samahan mo ako sa mall for 3hrs!

46. I don't want to spill the beans about the new product until we have a proper announcement.

47. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

48. Ang pagkakaroon ng malalakas na ingay mula sa kapitbahay ay binulabog ang kapayapaan ng tahanan.

49. Lalong nagalit ang binatilyong apo.

50. Sa kanyang masamang gawain, nai-record ng CCTV kung paano siya na-suway sa patakaran ng paaralan.

Similar Words

High-definitionhighest

Recent Searches

trainingmobilepasyadivideshighagastandartificialcesbokmapapacallpreviouslypersonsgenerateauthorobstacleshangaringideyacommunicateamingevilirogformtiyareadingechaveformaipapahingaclientessteerfredmind:seenanimomaliksiblusainaloktechnologicalalignssambitcreatingrepresentedimprovedinternalbasacontentpersistent,statingcommercestreamingcasesrelevantkitsusunodshifteffectmapadaliandroidformsjoedependinglivestructureentryharmfulbinilingbackmulingpupuntasystemadaptabilityconditionheftydinpautanghinalungkatpagsasalitaclockshockrequiregitaragapcompletetabathingmitigateclientesafeguiltymerejuniouminomsecarseipinaputingoverviewkumukuhaitinaasbaku-bakongnagpapaniwalanagtutulunganmagsalitakakuwentuhanpunung-punopagkalungkotpunong-punonapakahangaculturapinagmamalakipagluluksanaminmakaratingsapatosnakangisinghaponmagkaibigannagmakaawaconsistbaranggaypinakamatabangnakatunghaykaaya-ayangmagpa-checkupfansnaiinismagbabakasyonnagbanggaanmedya-agwapunongkahoymagkahawakrabealbularyotatawagnakapagsabisikre,papagalitanmangangahoynagpaiyakpamanhikannagandahannamulatnakakabangontumawagnagtutulakkabutihanmakatinakatirapanghihiyangnagpabayadtinangkanagsagawadisenyongnasasabihannasamagsusunurannagkasunogkatawangnakakagalanahawakannagsasagotnanlilisiknagsunuranmakikikainflyvemaskinerpagmamanehonahihiyanguusapanparehongdadalawinbefolkningen,nabubuhayalas-diyesnawalangnamumulotnakuhangmakapagsabihinilaaraw-kumidlatnabighaninanlalamigpagtutoldiscipliner,teknologipagsisisirebolusyonnegro-slavesnagmistulangemocionantesasamahanpinag-aaralannaiyaknakapasoknagpabottheirnaramdameclipxeso-calledfar