Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ano ang gagamitin mong hiwa ng baka?

2. Sumasakay ako ng taksi sa umaga araw-araw.

3. Jacky! Pare! nakangiti niyang sabi habang papalapit kami.

4.

5. La tos crónica dura más de ocho semanas y puede ser causada por una variedad de factores.

6. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

7. Walang huling biyahe sa mangingibig

8. Superman possesses incredible strength and the ability to fly.

9. Ang mga marahas na laban sa karapatang pantao ay dapat labanan at iwaksi.

10. Sa tindi ng init, pakiramdam ko’y nagbabaga na ang lupa sa ilalim ng aking mga paa.

11. Mas pinapaboran ko ang pulotgata kaysa sa kendi kapag gusto ko ng matamis na panghimagas.

12. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

13. Sa ganang iyo, dapat bang palawigin pa ang curfew hours sa ating lungsod?

14. Hindi siya malilimutin dati, ngunit nagbago ito nang siya’y tumanda.

15. Nagkakasayahan sila sa isang panig ng bilangguan

16. Sa anong tela yari ang pantalon?

17. Nang malapit na siya, nagtatakbo ang dalaga at nawalang parang bula.

18. Magtatampo na ako niyan. seryosong sabi niya.

19. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

20. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

21. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

22. Pinag-aaralan ng mga mag-aaral ang talambuhay ni Ramon Magsaysay bilang isang "Man of the Masses."

23. Ang guro ang nagsusulat sa pisara upang maipaliwanag ang leksyon.

24. Kahit ang diyosang si Venus ay walang panama sa kaniya.

25. Nagsimula ang kanilang kwento sa isang takipsilim.

26. The train was delayed, and therefore we had to wait on the platform.

27. Nagwelga sina Ka Leo laban sa pamahalaan.

28. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

29. Eine hohe Inflation kann die Wettbewerbsfähigkeit von Exporten verringern.

30. Las personas pobres a menudo viven en condiciones precarias y carecen de seguridad económica.

31. Dapat supilin ng pamahalaan ang mga kriminal na nagpapahirap sa mga inosenteng mamamayan.

32. Si Carlos Yulo ang naging inspirasyon sa pagbuhay muli ng gymnastics program sa Pilipinas.

33. Ang mga magsasaka ay nahihirapan sa kanilang ani dahil sa matinding tagtuyot.

34. Madali naman siyang natuto.

35. The momentum of the protest grew as more people joined the march.

36. They have organized a charity event.

37. Maraming ideya na ibinibigay ang brainly.

38. Muling nabuo ang kanilang pamilya.

39. Natandaan niya ang mga panunuksong iyon.

40. The invention of the telephone led to the creation of the first radio dramas and comedies

41. Sa isang forum ng mga mamimili, ibinahagi nila ang kanilang mga mungkahi upang mapabuti ang kalidad ng mga produkto.

42. Sasabihin ko na talaga sa kanya.

43. Tak kenal maka tak sayang.

44. Nais ko sanang sabihin sa iyo na may gusto ako sa iyo nang mas maaga pa.

45. Sumali ako sa Filipino Students Association.

46. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

47. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

48. Sa dakong huli, nakita ko ang aking kaibigan na umiiyak sa sulok ng classroom.

49. Ah yun ba? Si Anthony, taga ibang department.

50. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

Similar Words

High-definitionhighest

Recent Searches

highkumarimotcomepinakingganiiklijunjunreleasedbetanagbabasanangyarilumalangoyugatbusyanghapagphilanthropypagkaimpaktohumahangoskapasyahanhuertomagbibigayanak-pawispapanigmakuhanatutuwabalediktoryanarbularyodumilatintramurosamericakontingplantarpinanawandiretsahangedukasyonbrindariatfnagpapakainpagkainisitinuturomaayosbumililimitanimnagtaposbaronghinahanapattackmangyariilawcoachingmanilaindustrylinalilipadtataastinikagegulangpinoyakongmilyonglikurannatatanawbarung-barongtanggalinmaglutomahalinairconbookspagputianithankawitandvdbihiramagisipnagisingmapahamakresortsumuotpetsaitinalagangoutlinetopic,amparolargergabrielinangmoneynakahaintindera2001scalebulapongbalesonidoiwanlutuinahhsesamenag-replynaminmatulunginbasurapaglulutomatiwasaypananakotgaganaghanaplibaglalongmauupomournedisinumpabetweenpinalitannagtatampomatindienforcingmalagosanabagyopinaghandaanauthorbitaminamasayang-masayangbayaranrecentlykinabibilangankawalipaghandaewanlagnattigreasopagtitiponnagtatakangharipasasalamatsumusunomalapitpaghakbangiloilotignanpalitanmaibalikancestraleselvisrosariohumampashinandenkitang-kitaparoroonaparapinalayasinteragererbilanggonakakabangonsasakyanbagongkawili-wilipisokundimanhelpyoungingisi-ngisingtumahimikpinagsikapanpakikipagtagpolilimdahan-dahanpasinghalnagmadalingestudyantenagngingit-ngitmamahalintraditionalcontrolarlasmahiyalabinsiyampaghuhugasgawaingkondisyonvitamindalawampupetroleumumarawmakasamasubject,setshawaksangaunahinalagamaranasansinisimakikipagbabagsuchsiko