Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Les maladies mentales sont souvent mal comprises et stigmatisées dans de nombreuses cultures.

2. "Maghintay ka lang," ani ng guro sa kanyang estudyante.

3. The momentum of the ball was enough to break the window.

4. Su obra más famosa es la escultura del David en Florencia.

5. Las labradoras son conocidas por su energía y su amor por el agua.

6. Bumili si Ryan ng pantalon sa palengke.

7. Saan pupunta si Larry sa Linggo?

8. Inakalang ligtas ang lugar, pero may paparating palang bagyo.

9. Ang kalangitan ay nagbabaga sa pulang liwanag ng dapithapon.

10. Ano ang paborito mong pagkain?

11. Les banques jouent un rôle clé dans la gestion de l'argent.

12. Minsan, masarap din namang kumain ng nag-iisa para mapag-isipan ang mga bagay-bagay.

13. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

14. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

15. Tumagal ng tatlong oras ang kanyang operasyon.

16. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

17. I usually like to tell a joke to break the ice at the beginning of a presentation.

18. Matapos ang kanyang tagumpay, si Hidilyn Diaz ay tumanggap ng maraming parangal mula sa gobyerno at pribadong sektor.

19. He used his credit to buy a new car but now struggles to make the monthly payments.

20. The mission was labeled as risky, but the team decided to proceed.

21. Sapagkat matagal na ring sumasamba sa mga anito ang mga katutubo, hirap na hirap si Padre Novelles na manghikayat.

22. Instagram has become a platform for influencers and content creators to share their work and build a following.

23. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

24. Wer zuletzt lacht, lacht am besten.

25. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

26. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

27. Ehrlich währt am längsten.

28. Les jeux peuvent avoir des règles et des limitations pour protéger les joueurs et prévenir la fraude.

29. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

30. They have lived in this city for five years.

31. Wala naman sa palagay ko.

32. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

33. Anong buwan ang Chinese New Year?

34. Hindi dapat natin balewalain ang pag-unlad ng ating komunidad, samakatuwid.

35. May I know your name for networking purposes?

36. Nangyari ang isang malaking proyekto sa aming lugar dahil sa bayanihan ng mga residente.

37. He was already feeling embarrassed, and then his friends started laughing at him. That added insult to injury.

38. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

39. Scientific data has helped to shape policies related to public health and safety.

40. Sa gitna ng kaharian ng Renaia, isang dalaga ang nakatira sa munting palasyo.

41. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

42. Ang kalayaan ay hindi lamang tungkol sa pagiging malaya sa pagpapahayag ng ating mga saloobin, ito rin ay tungkol sa pagpili ng ating mga sariling desisyon at pagpapasya sa ating buhay.

43. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

44. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

45. Ikinalulungkot ko ang balitang yan.

46. Sa bawat kompetisyon, dala ni Hidilyn Diaz ang pagmamalaki at pagmamahal niya sa Pilipinas.

47. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

48. May problema ba? tanong niya.

49. Der er ingen fastlagte regler for, hvordan man bliver kvinde, det er en individuel proces.

50. This house is for sale.

Similar Words

High-definitionhighest

Recent Searches

beretikumidlattinitindahighhayopngusobrindarmaingatgrahampabiliconclusion,dinaluhanparathingskamaonadadamayhjemisinalaysaynanghahapdibagkusipinatasapagkaingkinagabihancarbonwaringtayominabutinapakamotnagkapilatistasyonnagre-reviewmatandang-matandachickenpoxmagpakasalnararanasanpagpasyentematulogdapit-haponlednanlilimosgabingkilonag-iisangdumatingevolvenagkakasayahanmagmulanagpalutomakatatlonagtagpotungkodnararamdamanpag-itimnatingalaisinalangmagingnanakawanmagworkmungkahilivemacadamiamakatiyakandsakristandustpanmarmaingutak-biyainsidentepaaralankahusayannapapag-usapanmananaigipinagdiriwangibonnapakabilispaghusayanmininimizepaki-basaibabanakakapamasyalskypemagpapapagodpandidirimahalnagkasunogmagkaibangpasasalamatcalidadhelpbangkamanananggalinteragererlasinggeronagpipiknikpangangatawannagkakamalipagbabagoclasesendelignalasingkakaibangmakapaibabawanywheremasasarapmagnifysang-ayonpakinabangant-ibanglandslidenagpasamafeedbackshiftconnectionbasketbolnakikini-kinitanag-aalayfuncionesnag-eehersisyosambitbinulabogtechnologyhanginpintopagkakilalaaaisshmagpa-checkupmananakawsedentaryadaptabilitynuevapalikuranpasensyarawmakikikainlumalakadpangungusaprelevantlabing-siyamimprovedsoftwarepa-dayagonallumabaspossiblenagpatimplahumiwalayaseannagdadasallumulusobautomationprogramahomeworknakasimangotlinggo-linggopangetsumimangotnakauposportsbalitangkatawangcriticsnangingitianmamayarestaurantpadabogexpressionscancerairportbumibilimakalawasalonnaiilangkumainturismosongskatieposporomagsalitacellphonemaysangagumulongbatang-batabironatalopadalasnapaluhodclassmatereviselimasawapowerpointleadersgloriahulihansapatosugatnapakaalatpobrengipinahamak