Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ano-ano pa po ang mga pinaggagagawa ninyo?

2. Plan ko para sa birthday nya bukas!

3. It was founded by Jeff Bezos in 1994.

4. Ang pagtanggap ng mga bisita at pagkakaroon ng masayang kasiyahan ay bahagi ng mga tradisyonal na okasyon sa Chinese New Year.

5. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

6. Hayaan na lang daw na mapagod ang mga mababangis na hayop at ibon sa pakikipaglaban basta sa kampo ng panalo siya sasama; hagikgik nito.

7. Ang poot ay nagpapalabo sa aking pananaw at nangunguna sa aking pag-iisip.

8. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

9. Eksport af tøj og beklædningsgenstande fra Danmark er også stigende.

10. We were stuck in traffic for so long that we missed the beginning of the concert.

11. Sweet foods are often associated with desserts, such as cakes and pastries.

12. Bis später! - See you later!

13. Ginamot sya ng albularyo.

14. A wedding is a ceremony in which two people are united in marriage.

15. Ang pagpapahalaga at suporta ng aking mga kaibigan ay nagpawi ng aking takot at pag-aalinlangan.

16. He has been working on the computer for hours.

17. Ang galing nyang mag bake ng cake!

18. Nangahas ang binata na sumagot ng pabalang sa kanyang ama.

19. Ang kasama naming lalaki ang nag-piloto nito.

20. Ailments can range from minor issues like a headache to serious conditions like cancer.

21. Bumili ako ng blusa sa Liberty Mall

22. May pumupunta sa Seasite minu-minuto.

23. Gawa ang palda sa bansang Hapon.

24. Mataman niyang inisip kung may iba pang nakakita sa nangyari.

25. Dahil lumamang naman sa pagkakataong iyon ang mga mababangis na hayop, sa kanila lumapit si Paniki.

26. Hindi niya napigilan ang pagdila sa kanyang labi nang naglalaway siya sa pagkaing inihain sa kanya.

27. Bilang paglilinaw, ang parangal ay ibibigay sa buong grupo, hindi lamang sa isang tao.

28. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

29. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

30. Matapos ang isang matinding pagsubok, hindi maiwasan ang paglabas ng malalim na himutok.

31. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

32. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

33. Ang mga kundiman ay nagpapahayag ng pighati at lungkot ng mga taong nagmamahalan.

34. Fødslen markerer en begyndelse på et nyt kapitel i livet som forældre og en påmindelse om, at livet er en konstant cyklus af transformation og fornyelse.

35. Magandang umaga po, Ginang Cruz.

36. Elon Musk is a billionaire entrepreneur and business magnate.

37. Ang pang-aabuso sa droga ay nagdudulot ng malalang problema sa kalusugan ng mga tao.

38. Sa kanyang lumang bahay, makikita mo ang kanyang koleksyon ng mga antique na kagamitan na hitik sa kasaysayan.

39. Mahirap magsalita nang diretsahan, pero sana pwede ba kita ligawan?

40. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

41. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

42. Nasaktan siya nang salatin ang mainit na kawali.

43. "Dogs come into our lives to teach us about love and loyalty."

44. La entrevista produjo una oportunidad única para conocer mejor al autor.

45. Nangyari ang isang insidente na nagdulot ng takot sa kanya, kaya't nais niyang maglimot na lang tungkol sa pangyayaring iyon.

46. La moda de usar ropa estrafalaria está llamando la atención de los jóvenes.

47. Mula sa tuktok ng bundok, natatanaw ko ang magandang tanawin ng kapatagan.

48. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

49. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

50. Magkasingganda ang rosas at ang orkidyas.

Similar Words

High-definitionhighest

Recent Searches

highwaritulongnganinumankaugnayanenfermedades,paskonakapayongpondoisinasamaphilippinecampaignsnagpapaypaycandidateangkanmaglalaropagtuturomestpunung-kahoynakakatawanagtatakbopag-indakbagkus,nagtungonagsunuranpagka-maktolmatanapatawadlibresedentarypagluluksaselebrasyonangelicaluluwasvaccinesnapailalimisasagottutungobrancher,ihahatidpagkabiglaibiniliconectanopgavertagakbanggainnagbagonamadisyembresumisidkriskatulangitonamasyalbataycardproperlydiscoveredbusogparkingnangyarikilalatinungosizepangitcultivationreportspecializedminuteabiipinabalotadecuadobroadcastingcrossflyhapdicauseschickenpoxgranadalearninghatepakitimplaseparationtugontinulungantiyakclimamayamannamingumawayandecisionsbalediktoryansocialikinasasabikanumanbinanggalivepangyayaringgoddahilnagsusulatmaintindihanpatingtakespinakamatabangkitangnagmamadalisuzettetabasmaghilamostabinglibertygusaliagadcountlesspagkabatapagtutoliligtash-hoypahirapantaolintauniversitiesnaramdamanngayotagtuyotarawelepanterosaano-anosalarinbagamatspellingcasesaleseditorsalatdentistabisikletaeskwelahanaga-agatennisnatanongpaaralanchangecapacidadtaong-bayanyakapnapakaniyananasusulitfilmspaghinginakakitai-googleniligawanvampiresmisaperfectechavemaramotwhetherinfinitymaliksikulaynagawanneedsmadilimapatNakaririmarimdumaantuminginusazebrakasoikinatuwaotraskampoginagawaprogramalinggo-linggomalusogmanunulatginawangcomunicarsebusyangsawakantahaninaapipagdatingplatformyukolalakengauditmatangkadmalihisumano