Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ano ang ikinatatakot ng mga tao sa bagyo?

2. Bukas na lang ako pupunta sa bangko.

3. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

4. The dancers are not rehearsing for their performance tonight.

5. Ang masakit na alaala ay patuloy na nagpapalala sa kanyang hinagpis.

6. Limitations can impact one's career, relationships, and overall quality of life.

7. Online traffic to the website increased significantly after the promotional campaign.

8. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

9. La labradora de mi hermana es muy cariñosa y siempre está buscando atención.

10. Magkaiba man tayo ng landas ay tiyak kong magkikita pa din tayo.

11. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

12. A lot of time and effort went into planning the party.

13. Kahit ilang beses ko na siyang tawagin, tulala pa rin siya sa kanyang pagmumuni-muni.

14. Binigyan sya ng dentista ng gamot matapos syang bunutan ng ngipin.

15. Sa dapit-hapon, masarap mag-meditate at mag-isip-isip sa mga bagay-bagay.

16. Sa naglalatang na poot.

17. Huwag kang lalayo nang palayo sa amin para hindi ka mawala.

18. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

19. Bago siya ipinatay, si Rizal ay isang aktibistang politikal na lumaban sa korupsiyon at pang-aabuso ng mga Espanyol sa Pilipinas.

20. Nanalo si Ton Ton bilang presidente ng kanilang paaralan.

21. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

22. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

23. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

24. Sa pamamagitan ng isip ay pinaglagablab ni Tarcila ang barko ng mga pirata.

25. La entrevista produjo una oportunidad única para conocer mejor al autor.

26. Nakahain na ako nang dumating siya sa hapag.

27. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

28. Magtatapos ako ng aking thesis sa buwan na ito, datapwat kailangan kong maglaan ng mas maraming oras para dito.

29. Ang pagtulog ay isang mahusay na paraan upang makalimutan pansamantala ang mga alalahanin at stress.

30. Natakot ang pusa sa tunog ng paputok kaya't kumaripas ito papasok sa bahay.

31. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

32. Las labradoras son perros muy versátiles y pueden adaptarse a una variedad de situaciones.

33. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

34. Practice makes perfect.

35. La formación y la educación son importantes para mejorar las técnicas de los agricultores.

36. Isang binata ang napadaan at tinangkang kumain ng bunga ng puno.

37. Mahirap mahalin ang isang taong mailap at hindi nagpapakita ng tunay na damdamin.

38. I just got around to watching that movie - better late than never.

39. O sige, ilan pusa nyo sa bahay?

40. The basketball court is divided into two halves, with each team playing offense and defense alternately.

41. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

42. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan keyakinan pada kemampuan kita sendiri.

43. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

44. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

45. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

46. By the way, when I say 'minsan' it means every minute.

47. Tuwing sabado ay pumupunta si Nicolas sa palasyo para dalawin si Helena.

48. Kapag aking sabihing minamahal kita.

49. The ad might say "free," but there's no such thing as a free lunch in the business world.

50. Cosecha el maíz cuando las espigas estén completamente maduras

Similar Words

High-definitionhighest

Recent Searches

highsulinganyonmulti-billionchambersmakilingofferpressnag-alalaclientefrogviewtumuborelievedinteriorcakesanclientesbabeincreasecontinuesourcesyncreturnedfuturesolidifytechnologyflashnakaupodipangproblemalalakinalugmokisdangbinibiyayaaninferioresinomalexandergumisingencounterlagnatpapuntanghalikakamustaspellingbarongpopcornonetaingaaffiliateyoutubeyumakapgandanami-missbinibiliumanoganitosamakatwidbilangclientsultimatelypakibigyaniatfipapaputolasoarguedahanpinakamahalagangrosariotumakastaga-hiroshimasulyappanalanginatensyongsunud-sunurantamanakatunghaykinatatakutanikinakagalitgobernadornangagsipagkantahankakilalamuliplantaskonsultasyonpagsalakaykapatawarannapapatungomakakawawaartistaskabundukanmakapalagnagpagupitkapamilyanamumutlanakayukomensajessumusulatkapatagannaabotnagdalaisusuotnakaakyatkatolisismonaalisrektangguloalapaapnanunuripuntahanhanapbuhaymagkasamamagpapigilnahigitandadalawcualquiermarketingnanalopakinabanganmakawalaagostoibilimakakainiangatporgatasbinitiwankambingmatikmanpnilitmariemagsimulasagotpinilitself-defensehotelkendilunesestategigisingtomorrowsiniyasatpayginoomatipunobagamatburdendagatnaggingisinakripisyoformisamamulighederrenatoangaldesarrollartsuperdasalhappenedbingowalongkingdomipantalopiyanvistroselleseeknagtatakamaitimdagabumahamaskmalldiamondsorrytenipinabalikabenepasyaotraswidespreadnewsellenmatabapinunitbelieveddaangumantimind:itloginternetpossiblemapapasedentarydumatingtwotoolelectnegativegotsome