Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. There were a lot of people at the concert last night.

2. When it comes to politics, it can be tempting to bury your head in the sand and ignore what's going on - after all, ignorance is bliss.

3. He has been to Paris three times.

4. Marahil ay dapat kang mag-isip-isip muna bago magdesisyon sa mga bagay-bagay.

5. Parang kaming nageespadahan dito gamit ang walis at dustpan.

6. Kapag may tiyaga, may nilaga.

7. Los bebés pueden nacer en cualquier momento del día o de la noche, y algunas veces pueden llegar antes o después de la fecha prevista.

8. The news might be biased, so take it with a grain of salt and do your own research.

9. Lumaki si Ranay na ang trabaho ay kumain at ang libangan ay kumain parin.

10. Napansin ko ang bagong sapatos ni Maria.

11. Keep studying and hang in there - you'll pass that test.

12. A lot of money was donated to the charity, making a significant impact.

13. Saan pupunta si Larry sa Linggo?

14. Hindi nakagalaw si Matesa.

15. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

16. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

17. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

18. Tsuper na rin ang mananagot niyan.

19. Pagkatapos ng isang daang metro kumanan ka.

20. Está claro que la evidencia respalda esta afirmación.

21. Some limitations can be temporary, while others may be permanent.

22. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

23. Einstein's work also helped to establish the field of quantum mechanics.

24. Mahalagang magtiwala sa ating kakayahan upang maabot natin ang ating mga pangarap, samakatuwid.

25. Gusto kong mamasyal sa Manila zoo.

26. Ang mga palaisipan ay hindi lamang nagbibigay ng hamon sa ating kaisipan, kundi nagbibigay rin ng mga oportunidad para sa pagpapalawak ng kaalaman.

27. Kapag tag-araw ay malaki-laki rin ang kinikita ng mga agwador.

28. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

29. Pedro! Ano ang hinihintay mo?

30. Anong oras gumigising si Katie?

31. Masayang-masaya ako ngayon dahil nakapasa ako sa board exam.

32. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

33. Nakakamangha naman ang mga tanawin sa lugar nyo Edwin.

34. Sumasakay si Pedro ng jeepney

35. Minsan, ang mga tao ay nagigising sa gitna ng gabi at nahihirapan na makatulog muli.

36. En ren samvittighed kan give os en følelse af ro og tilfredshed.

37. Kumaripas ng uwi si Pedro matapos niyang marinig ang masamang balita.

38. Napaluhod siya sa madulas na semento.

39. Tila may nagseselos sa bagong kasapi ng grupo.

40. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

41. Sa mga lugar na mabundok, naglipana ang mga halaman na katangi-tangi sa kanilang ganda.

42. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

43. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

44. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

45. Nasa Canada si Trina sa Mayo.

46. Las vacaciones son un momento para crear recuerdos inolvidables con seres queridos.

47. Gusto mo ba ng mainit o malamig na kape?

48. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

49. Unser Gewissen kann uns vor schlechten Entscheidungen bewahren und uns auf den richtigen Weg führen.

50. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

Similar Words

High-definitionhighest

Recent Searches

highiyakpagkaimpaktoislandkutsaritangiyanmalimagpapabunotnami-misscouldlitosang-ayonarbularyonag-iisangkinaiinisansignakakatakotteknolohiyakumukuhanearsamakatuwidkontinentengnagpapakinistaleadditionallybulamakabilisangkalayaanlaternakasimangotrumaragasang2001flyvemaskinerdaigdigsimuleringerhanginpieractivityneamagpa-pictureupworksofanumberquezonanumantiemposabercanadakruslimitpagkalungkotkinatatalungkuangsalu-salopagka-maktolpinakamaartengdi-kawasamagsusunuraneskuwelamakapagsabipagkakataongbaranggayikinalulungkothinagud-hagodpagkakayakaphalu-halomakasalanangtumahantumalimnapapansinsundalohandaanproductividadlalakadmasasayaroommagpakasalnakapasokkaharianpinamalaginaulinigankalaunandaramdaminmahiwaganggagawinrebolusyonmenumadalipatakbopaidmaasahantutusinnagsmilegasolinamagpapigililalagaythanksgivinglumutangnaantiginiresetana-curiousiligtasoperativoscanteenmahalmagselosika-50alas-dosecantidadasukalhinilamatutongkonsyertopagongtindahanhiramrewardingtuyohopebihasamatangkadlilikomahigpitdiliginbibigyanmabibinginatakotmatandangrimasdiseasesnapagodlaranganlalongmangingibigmagdilimnapakelangandialledbutascomembalokuyauntimelydisseconsumegodtanywhereituturonakinigkontingsandalimamayausedlapitanipinaalam1940binawi1954butchindiasigapangitjaneseektools,postcardlargercriticsmadamibisigdahilanseesaanjudicialidoletsyniyaeyeinisdilalayuninwifikamituwanitonag-pilotocoaching:nginingisihanlot,1920sjunioclienteslikelyviewsmuchosharmfulipinikitprofessionalcontrolaclock