Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Scissors are commonly used for cutting paper, fabric, and other materials.

2. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

3. Argh. Parang batang bading naman eh. Anubayan.

4. Who needs invitation? Nakapasok na ako.

5. Paglingon ko, nakita kong papalapit sakin si Lory.

6. Sa loob ng ilang taon, yumabong ang industriya ng teknolohiya sa bansa.

7. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

8. Napangiti ang babae at umiling ito.

9. Alangan ako?! Ako na nga unang nagbigay eh! Ikaw naman!

10. Mobiltelefoner, tablets og computere er eksempler på elektronik, som mange bruger hver dag.

11. Mas magaling siya kaysa sa kanya.

12. Pumunta kami sa Cebu noong Sabado.

13. Aalis siya sa makalawa ng umaga.

14. Ang carbon dioxide ay inilalabas ng mga tao.

15. Bumalik siya sa lugar ng aksidente at tulala sa nangyari.

16. Twitter chats are organized conversations on specific topics, usually held at designated times using a specific hashtag.

17. Ilan po ang lalaking pumasok sa restawan?

18. Siya ay hinugot mula sa kanyang pagkakakulong matapos ma-prove na walang kasalanan.

19. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

20. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

21. Di ko sya maistorbo dahil sya ay nag-aaral pa.

22. Aanhin ko 'to?! naiiritang tanong ko.

23. El romero es una hierba aromática que se usa frecuentemente en la cocina mediterránea.

24. Football coaches develop game plans and strategies to help their team succeed.

25. Inflation kann durch eine Zunahme der Geldmenge verursacht werden.

26. Nagtatrabaho ako tuwing Martes.

27. Sa mga mahahalagang desisyon, nagkakasundo kami bilang magkabilang kabiyak.

28. La science est la clé de nombreuses découvertes et avancées technologiques.

29. Nag-usap kami kamakalawa ng tanghali.

30. Kumain ka ng gulay upang maging malusog ka.

31. Nagbuntong hininga sya, Akala ko naman.

32. Setiap individu memiliki hak untuk mengamalkan agamanya sendiri dan menjalankan ibadah sesuai keyakinan masing-masing.

33. Las escuelas son responsables de la educación y el bienestar de los estudiantes.

34. Anong nakakatawa? sabay naming tinanong ni Sara

35. Sino ang sumakay ng eroplano?

36. Sama-sama. - You're welcome.

37. Palaging sumunod sa mga alituntunin.

38. Biglang kumaripas ng takbo ang magnanakaw nang makita ang mga pulis.

39. Hindi ako makapaniwala sa nakikita ko.

40. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

41. Technology has also had a significant impact on the way we work

42. Es freut mich, Sie kennenzulernen. - Nice to meet you.

43. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

44. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

45. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

46. Sa condo ko. nakangiti niya pang sagot.

47. Ang bato ay hindi mahuhulog kung walang sisidlan.

48. Masakit ba ang lalamunan niyo?

49. La labradora de mi sobrina es muy amigable y siempre quiere jugar con otros perros.

50. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

Similar Words

High-definitionhighest

Recent Searches

tiemposhighmahihirapblogkahitpetkumakapitawajingjingpaginiwanandrewbisitanakuhaturoneithermag-inamanycomplexmagsungitmag-anakredroofstockpangangatawantaun-taonpagkaingayonnami-missmadridkatagalanpupursigibernardohapasincreatinghayaannatingkalalaronagpalalimcoatvampiresmarchcomienzanconectadosnakatirangpinapagulongencompassesmanuksoasoadobotupeloprotestasecarseevilledexitsedentaryhitsurakinikilalangnagwelganagandahandidlalakadmaisusuotkasintahanmasasalubongsystems-diesel-runipihitpersistent,nageenglishnagsusulattabing-dagatzebraonlinebaittikethitikgoodeveningsetyembresumisilipmaistorbomanirahankondisyonhanapbuhaynaiilangsariwamayamanindustrykidkiranmagkasabaynalalabingsinaliksiknagtutulakngingisi-ngisinggayunmannaabutankumidlatjobsminu-minutoguerrerokapatagannaantigpakakasalanwondereconomicmetodiskdesign,maranasanpumayagrobinhoodtayohunicurtainshukayplayssumangharmfulintroduceiconcompostelaleoweddingbecomingwordkatutuboagam-agamnakakarinigkumaliwacarbonpananglawmulti-billionnangyaribarnakararaanclientesnandoontumawatinitignannahihilonuevosmabangisganoonyourself,hinilatenertuvonakatitigbumitawmaibibigaymalagopang-aasarresignationcitizenmodernebeginningsrestawanbasahanjoshlegendsmakahingiestilosdikyamsurroundingsolivianag-asarankinikitamakalaglag-pantyrespectmagkamalinagmungkahirenombrelalargabulalasmantikaeksempelbalahibomalapalasyoambisyosangkalikasanmini-helicopterpayongnatitirahanapinlakadilagaydreamspaboritobutikumustababaetangingobstaclesalepaslitbridekatulongstrategypyestapetsalegislativemagigitingtradisyon