Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

2. Gumagalaw-galaw ang sabog na labi ni Ogor.

3. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

4. Ang trahedyang naganap sa kanilang komunidad ay nagdulot ng pangmatagalang lungkot sa kanilang mga puso.

5. Hawak nito ang isang maliit na bangos na tig-bebente, sa loob-loob ni Aling Marta.

6. At blive kvinde handler også om at finde sin egen stil og identitet.

7. Naglabas ako ng malalim na himutok matapos kong matalo sa paligsahan.

8. Ang hinagpis ng isang ina ay dama sa kanyang bawat hikbi habang inaalala ang kanyang nawalang anak.

9. Tila uulan ngayong hapon dahil sa madilim na ulap sa langit.

10. The website's analytics show that the majority of its users are located in North America.

11. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

12. Gawa/Yari ang Tshirt sa Tsina.

13. Ang pagdating ng mahigpit na bagyo ay nagdulot ng malalakas na alon at binulabog ang mga bayan sa tabing-dagat.

14. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

15. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

16. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

17. Maraming uri ng mga punong-kahoy na maaaring gamitin sa paggawa ng mga gamit tulad ng upuan, mesa, at iba pa.

18. Les travailleurs doivent respecter les heures de travail et les échéances.

19. Nang balingan ng tingin ang matanda ay wala na ito sa kanyang kinatatayuan.

20. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

21. Nakatingin siya sa nakasahod na balde ngunit ang naiisip niya'y ang bilin ng ina, na huwag na niyang papansinin si Ogor.

22. Salamat na lang.

23. La paciencia es necesaria para alcanzar nuestros sueños.

24. Ang tagumpay ng kanilang proyekto ay lubos na ikinagagalak ng kanilang grupo.

25. Las heridas en la cara o cerca de los ojos deben ser evaluadas y tratadas por un especialista en oftalmología.

26. Iiyak ako pag hindi ka pumayag maging bestfriend ko.

27. Galing lang ako sa mall. Naggala lang ako.

28. The early bird catches the worm.

29. Ang albularyo ay gumamit ng langis at kandila upang tukuyin kung may masamang espiritu sa bahay.

30. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

31. Agad na kinuha ni Mang Kandoy ang kanyang itak at tinaga ang mangkukulam.

32. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

33. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

34.

35.

36. The invention of the telephone led to the creation of the first radio dramas and comedies

37. Alam ko na hindi maganda ang agam-agam ko, kaya kailangan kong magsumikap upang malunasan ito.

38. Candi Prambanan di Yogyakarta adalah candi Hindu terbesar di Indonesia dan merupakan situs warisan dunia UNESCO.

39. Napatingin ako sa kanya bigla, Kenji?

40. Malapit na naman ang eleksyon.

41. Eh kelan niyo ba balak magpakasal?

42. Ein Bild sagt mehr als tausend Worte.

43. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

44. Sa labas ng bintana, natatanaw ko ang mga batang naglalaro sa kalye.

45. Madalas banggitin si Carlos Yulo sa mga balita tuwing may malaking kompetisyon.

46. Gusto mong pumasa sa pagsusulit? Kung gayon, dapat kang mag-review nang mabuti.

47. Hinihiling ko lang sana na sa aking pagpanaw ay kunin mo ang aking puso, sunugin mo, at ilagay sa banga ang abo nito.

48. Dapat mong namnamin ang tagumpay na iyong pinaghirapan.

49. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

50. Mathematics is a language used to describe and solve complex problems.

Similar Words

High-definitionhighest

Recent Searches

highmalapitprinsipengdollypatutunguhanmagnakawcaracterizamaayosunahiniconssuccessfulhangaringpracticesadaptabilityperwisyoabovepanatilihinuniversitysumpaparimatanggapsigekawalancigarettesmagka-apoprospergelainapapasabayiniirogpadalasbinentahanginawangmag-asawaimpornag-aaralmahiwagangmagpaliwanaggenematagpuangasolinakusineropaki-chargesinabimaghihintayginawaranstorytumigilhinogresearch,sementoroofstockescuelasnakabaonbumabababulamonglalongkenjibaryotawajobutilizarpublishing,alaynatagalanproducts:tillnakatinginggrammarhugisreguleringmadamiwordbinawibitiwanmenoshisasinmabilisbernardosearchgracereservationlaylaypumuntaelectionsboracayanimqualitycasesexpectationssharehimutokiyosiyang-siyaestablishedsalapiprocessmenucharitablepersonsdiindoktortheirmamayagooglebagonglibohinanapitinaastumatawaarawpopularkutodpanindaadmiredpinatirafitnesswidelynasiyahanduladagaschedulehumabolbalik-tanawspansmamidisyempredeletingthereforebansaprogresssolidifyinventionnauwilagisumasakaybinibilangasiaticlinggo-linggootherskasalgayunpamanpinagawanananalongtaga-nayonmagkakagustonakakunot-noongnangahasmakapalagnananaginipmalakihunibakasyonsimbahasiksikaninabutantv-showsmedicaltig-bebeintepakukuluanpeksmanpaninigasmataaasiyongarabiaandreapagsusulitnagpasaniikutanconvey,silamatayogpatiencepersonsnobpaskokalongkapelaryngitismag-asawangtelevisedmakaangalbinabaanchambersdemocraticitakmajoratagiliranasodownsofapartlockdowncontinuesuniqueskillfaceipihitform