Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Bwisit talaga ang taong yun.

2. Size 6 ang sukat ng paa ni Elena.

3. "Ang pera ang ugat ng lahat ng kasamaan" ay isang bukambibig na nagsasabing ang pagkakaroon ng pera ang dahilan ng iba't ibang problema sa mundo.

4. Si Hidilyn Diaz ay isang inspirasyon para sa maraming Pilipino, lalo na sa mga kabataan.

5. Las plantas pueden entrar en un estado de dormancia durante el invierno, reduciendo su crecimiento.

6. Bumili si Ana ng regalo para diyan.

7. Pinuri umano ng mga eksperto ang bagong teknolohiyang inilunsad ng mga siyentipiko.

8. "Dogs come into our lives to teach us about love and loyalty."

9. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

10. Hindi ko alam kung paano ko malalampasan ang aking mga agam-agam tungkol sa aking trabaho.

11. Naghanda kami ng sorpresa para sa kanya.

12. Ano ang ginagawa mo nang nagkasunog?

13. Napakahaba ng pila para sa mga kumukuha ng ayuda.

14. Kumunot lang ang noo ko, That's not my name.

15. Marahil ay pagod ka na sa trabaho kaya't dapat kang magpahinga ngayong weekend.

16. Napakatagal sa kanya ang pagkapuno ng mga balde ni ogor.

17. Buwal ang lahat ng baldeng nalalabi sa pila.

18. Ate Annika naman eh, gusto ko ng toy!

19. Haha! I'd want to see you fall inlove tonight.

20. Ito rin ang parusang ipinataw ng di binyagang datu sa paring Katoliko.

21. Nahawa ako ng kuto sa kapatid ko.

22. Doa juga dapat dijadikan sarana untuk memohon perlindungan dan keberkahan dari Tuhan.

23. Hindi maganda ang magkaroon ng maraming utang dahil ito ay nagdudulot ng dagdag na gastos at kahirapan sa buhay.

24. Sinalat niya ang kanyang bulsa ngunit wala roon ang kanyang cellphone.

25. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

26. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

27. Ang kanilang tirahan ay nasa mababa na lugar kaya laging binabaha.

28. Psss. si Maico saka di na nagsalita.

29. i Maico. Pagkuwan eh parang batang nagdabog siya.

30. Berbagai lembaga dan organisasi keagamaan berperan aktif dalam memberikan pelayanan sosial, pendidikan, dan bantuan kemanusiaan bagi masyarakat Indonesia.

31. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

32. Isa sa kanyang kasamahan sa bilangguan ay si Tony

33. La ingesta adecuada de fibra puede ayudar a regular el sistema digestivo y mantener la salud intestinal.

34. Portion control is important for maintaining a healthy diet.

35. Ang gusto sana namin ay dalawang double beds.

36. I'm going to surprise her with a homemade cake for our anniversary.

37. Biglang naalaala ni Aling Rosa ang huli niyang sinabi kay Pina, na sana'y magkaroon ito ng maraming mata para makita ang kanyang hinahanap.

38. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

39. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

40. Hindi ako sang-ayon sa pag-uugali ng ilang mga kabataan ngayon.

41. The movie was absolutely captivating from beginning to end.

42. All these years, I have been discovering who I am and who I want to be.

43. Maliit ang telebisyon ng ate ko.

44. Uy, malapit na pala birthday mo!

45. Ano pa ho ang dapat kong gawin?

46. She donated a significant amount to a charitable organization for cancer research.

47. Gusto niyang lumayo at maglakbay palayo sa lugar ng kanyang kabataan.

48.

49. Sino-sino ang mga nagsibili ng mga libro?

50. Nag-aabang ang mga kabataan sa kalsada habang nagiigib ng balde-balde ng tubig para sa kanilang water balloon fight.

Similar Words

High-definitionhighest

Recent Searches

stagecesdinalahighrolemagkakaanakmaibaheartlandasremoteiginitgitviewcomunicarseattorneyallowsbroadcastingbetahapdiextrahulingwoulduponnariningresultagayunpamanalituntuninblusaipinanganaktuminginexistlangitpamilyanggalaankumikilosenglandkangkababalaghangnanonoodniyogika-12tumalimmeanslagaslasbiologikalabannapakabiliskakayananukol-kaytumabinapagodiconicshockmakapilingperpektingnakikitakalannagkalapitmakapagsalitanapakabinanggadaraannakaluhodmagkakailalaborsinulidcomunicanpagkalitomagasineskwelahanpinagsanglaanmarasiganpagtangisngayongbumilisaplicacionesnagagamitkabutihanlabing-siyamitinatapatpahabolproduceunconstitutionalnatanongnatigilangbituinmagamotyearpayatguhitkitangeksaytedworkingibat-ibangbranchesbagpowerrailginisingditostaramongguardalabingpagsusulattinatawagtinaasanpatutunguhanmakakasahodpinagpatuloyrevolucionadokagandahagnakikilalangtaga-nayonnamumuongmaputulanbanalwakaspagsusulitmaghapongvaledictoriannaghubadpakilagaymaynilaxviiasukalmakapangyarihangkinakitaannalulungkotkawili-wilibaku-bakongkwebangcrecermaghahatidpinyapagtawamagkaharapnanlalamigmumuntingkasintahandaramdaminuugud-ugodnagmadalingnag-uumigtingnagreklamonagliwanaginasikasopagkabuhaymahiwagangopgaver,makidalonakapagsabikumikinignaglaroumuwininanaispandidiringumiwiuugod-ugodlalakadinaaminmalapalasyoambisyosangmontrealmaanghanglalabasintindihinsalbahenglumayolumibotpamumunopagsagotsundalolabinsiyamkapagkanilangmallsabihinantibioticsfranciscokakilalabakantemangyarimahuhulicountryjejuinuulamopisinatumamisviolencebarung-barongtalinopanginoonkaratulangbilibidkuligligmagbigaysapatoslungsodmalalakitinatanong