Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang malalakas na paputok ng firecrackers ay binulabog ang kapayapaan ng gabi ng Bagong Taon.

2. Inalagaan niyang mabuti hanggang sa ito'y magbunga.

3. Makikita ko ang mga kapatid ko sa pasko.

4. Gambling er en form for underholdning, hvor man satser penge på en chancebaseret begivenhed.

5. Matapos ang mahabang panahon ng paghihintay, ang aking pag-aabang ay napawi nang dumating ang inaasam kong pagkakataon.

6. Bukas ay kukuha na ako ng lisensya sa pagmamaneho.

7. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

8. Isa sa nasa pagamutan na iyon si Bok

9. Napahinga ako ng malakas kaya napatingin siya sa akin

10. Kill two birds with one stone

11. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

12. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

13. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

14.

15. Ang bata ay na-suway sa kanyang magulang nang hindi sumunod sa kautusan.

16. Mag asawa na kayo pero hindi mo pa nasasabing mahal mo siya?

17. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

18. Ang paggamit ng teknolohiya ay nagbibigay daan sa iba't ibang uri ng hudyat, tulad ng emoji sa text messaging o facial expressions sa video calls.

19. Mahigit sa walong oras siyang nagtatrabaho araw-araw upang matustusan ang kanyang mga pangangailangan.

20. Pwede ko ba makuha ang cellphone number mo?

21. Nagsisilbi siya bilang doktor upang mapangalagaan ang kalusugan ng kanyang pasyente.

22. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

23. Ang pagiging malilimutin ni Peter ay hindi sinasadya; minsan ito ay dulot ng stress.

24. Ang aking teacher ay hindi muna nagturo ngayong araw.

25. pagkaraan ng kargang iyon ay uuwi na siya.

26. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

27. Time management skills are important for balancing work responsibilities and personal life.

28. This has led to increased trade and commerce, as well as greater mobility for individuals

29. Yumabong ang pagpapahalaga sa kalusugan ng mga tao dahil sa mga kampanya para sa mga aktibidad sa fitness.

30. Break a leg

31. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

32. Nakasandig ang ulo sa tagpiang dingding.

33. Maaari po bang makahingi ng sobra sa hapunan ninyo?

34. Ang nagbabago ay nag-iimprove.

35. Binibigyang halaga ng mga Pilipino ang talambuhay ni Ninoy Aquino bilang isang martir at simbolo ng demokrasya.

36. Inflation kann durch eine Zunahme der Geldmenge verursacht werden.

37. Sa huling pagkakataon ang mga isda ay nagsalita.

38. Todos necesitamos algo en qué creer y esperar en la vida. (We all need something to believe in and hope for in life.)

39. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

40. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

41. Diyan ang bahay ni Mr. Marasigan.

42. Nangyari ang isang malaking proyekto sa aming lugar dahil sa bayanihan ng mga residente.

43. Red horse? Ikaw? nagtatakang tanong ni Genna.

44. Magkano ho ang arkila ng bisikleta?

45. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

46. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

47. Ang nakapagngangalit, unti-unti na namang nalalagas ang kaniyang buhok.

48. Forældre har ansvaret for at give deres børn en tryg og sund opvækst.

49. Mathematics has many practical applications, such as in finance, engineering, and computer science.

50. Mahalagang alamin ang interes na ipinapataw ng utang upang malaman kung magkano ang babayaran na kabuuang halaga.

Similar Words

High-definitionhighest

Recent Searches

highkikitanakakabangonawtoritadonggusalisobracenterkilongayokomariokuwartokagalakanniyonkartonwalangpakainunangsumangtanyagimpormauuposeparationmaatimskirtclasespalakabesesbalakmulakainanhawakjannaipinansasahogcommunicationmagpalibrewalkie-talkienakangisingpagkakalutoipagmalaakimagkabilangprincipalesdiretsahangnangapatdanmagpaniwalaattentionnapagtuunanpaghalakhakmagpupuntaadvancementikinalulungkotpinagtatalunaninfluencepinakamaartengpakakasalansalenapakalakingkakuwentuhantinataluntonressourcernerevolucionadosundhedspleje,advertising,sabijenapambahaypagdudugohinihilingbienminu-minutotuwang-tuwaalaktabiunanhiwatiyaenergy-coalgeologi,medya-agwamagpasalamatmasukolmangangalakalmagsalitayeyna-fundhumalakhakna-curiousnaawamalalakinaninirahanpagdidilimgayunpamanpundidomagpa-picturepinagtagpolalakingpupuntahanintensidad11pmmoderneipinahamakmakangitimalayangselebrasyonbinibinigovernorsdakilangnagpupuntacommercialmahiwagangsarisaringnapakalakimaglalakadnagtalunanmalakingsorpresamahiwagaenglandexpresanlalakengmabatongbinibilisemillasiintayinsisidlantanghalimalimitnawalangkatagangihahatidphilosophicalbilaoperwisyosangamakikiligotalinotanghaliantahananparatinghatinggabiiniibigrecentnaalismagagawasinasadyamatalinopinagkiskiskinauupuannangangaralnamumulotpagtataposnagsasagotnakakitaagwadorgumagalaw-galawpinakamagalingkinatatalungkuangnakaramdamkinalakihankinumutannavigationmagturomagbantayairportpumitassharmainekakataposhumintoibinibigaynabighaniililibrebabasahinpinamalagisarilingnananalonglumutanghulihanmagagamitmakapagempaketumalonkontratanagagamitnaghilamosbowlgelaipinigilangumigisingnaliligonagbagosalaminmasasabibumaligtadsinisirafranciscopahabolnamumulamangyarimagsabibilihinpinabulaankapatagan