Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. I have been swimming for an hour.

2. May tawad. Sisenta pesos na lang.

3. Sa pagsasaayos ng aming barangay hall, nagkaroon kami ng malaking tagumpay dahil sa bayanihan ng mga residente.

4. The church organized a charitable drive to distribute food to the homeless.

5. Yumabong ang pagpapahalaga sa kalusugan ng mga tao dahil sa mga kampanya para sa mga aktibidad sa fitness.

6. Di nagtagal, muli niyang naramdaman na tila nangangalirang na naman ang kanyang balat.

7.

8. Magkita po tayo pagbisita ko riyan.

9. Kabilang na roon sina Lala, Dada at Sasa.

10. Dahil sa aksidente sa pagpapatakbo ng tren, ilang pasahero ang nagsusumamo para sa kanilang kaligtasan.

11. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

12. Natagpuan ko ang susi ko sa dakong huli ng aking bulsa.

13. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

14. Det har også skabt nye muligheder for erhvervslivet og ændret måden, vi arbejder og producerer ting

15. Drinking enough water is essential for healthy eating.

16. Mobiltelefoner, tablets og computere er eksempler på elektronik, som mange bruger hver dag.

17. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

18. Napangiti na lang ako habang naka tingin ako sa kanya.

19. Ang biglang pagkakaroon ng mga protesta ay binulabog ang kapayapaan ng lungsod.

20. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

21. Kulay itim ang libro ng kaklase ko.

22. At blive kvinde kræver også mod og selvstændighed.

23. Pakitimpla mo ng kape ang bisita.

24. Seek feedback, it will help you to improve your manuscript

25. Ang talambuhay ni Leandro Locsin ay nagpapakita ng kanyang husay at kontribusyon sa arkitektura ng Pilipinas.

26. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

27. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

28. Napakalamig sa Tagaytay.

29. Oh bakit nandito ka pa? ani Maico bilang tugon.

30. Siya nama'y maglalabing-anim na.

31. También es conocido por la creación de la Capilla Sixtina en el Vaticano.

32. Uh huh, are you wishing for something?

33. Ang mga lugar na madalas tamaan ng buhawi ay kailangang magkaroon ng mga pinalakas na imprastruktura at mga hazard mitigation measures.

34. La santé mentale est tout aussi importante que la santé physique.

35. Mas masarap ang pulotgata kapag inilagay sa ibabaw ng bibingka.

36. Natutuhan ng mga mag-aaral ang talambuhay ni Heneral Luna at ang kanyang ambisyon para sa pagbabago ng bayan.

37. Ang pagtulong sa iba o pagbibigay ng serbisyo ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

38. Umakyat sa entablado ang mga mang-aawit nang limahan.

39. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

40. Actions speak louder than words.

41. Ang pagmamahal sa pamilya ay hindi magpapakasawa.

42. Kapag mayroon kang kaulayaw, hindi ka mag-iisa sa mga pagsubok na iyong kinakaharap.

43. She prepares breakfast for the family.

44. The stock market is a platform for buying and selling shares of publicly traded companies.

45. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

46. Det kan være en rejse at blive kvinde, hvor man lærer sig selv og verden bedre at kende.

47. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

48. May naghubad na ng damit at isinampay na lamang sa balikat.

49. Have they finished the renovation of the house?

50. Pumunta ka dito para magkita tayo.

Similar Words

High-definitionhighest

Recent Searches

papuntaelectronichighmacadamiabigbulameetingefficientandroidconvertingtuyouwakindustriyabinge-watchingadvancementiniirogtiemposnegroskatotohananmeansspongebobnagtataepinigilanmensahelondonnakakatandamagpalagosundaloditobaranggaygeologi,podcasts,pulang-pulakumakalansinggandahantilpinangaralanmarketing:tumigilgumigisingdiyanpaosnearmawalakumaenmaibabalikpanunuksoundeniablenakabaonairplanessasagotkumbentolilymabaitwaterkarganglalakenakinigpare-parehomadamicompostelawesterapatinsnobbinawimagpapakabaitpersistent,umarawmakingtypesnaggingrepresentedsamakatuwidkinakabahanbabesolidifylahatnabiglanutrientes,aniasiakutsilyobaku-bakongpagapangdamipilamagkahawaknakagalawnakapagsabiitinakdangsaritabinanggaipinamililagikainupuanboseskapatawarangenerationsreviewerstaga-nayonmangenalagutantopicarbejdermaligayakambingcareernakasabitalintuntuninbutihingrubberclientsisulatlumingonoperahanna-fundlumalakadbisikletarepublicanwebsiteputimahiwagalinggo-linggoctricashesusprocesseslaptophalikanthirdsyncbuskinabubuhayjobsmagkaibacurtainsanilabinuksandatiopportunitymaghintaygawabangkalutoibinentajenachickenpoxcarbonmerondesarrollararkilapangkatreviewfathernakakadalawpakikipagtagpomagbagong-anyokawili-wilinapatungobopolsagricultoresasulbilinkamatisulammaskiguhitsantowalngmarioreaderslabingcomplicatedbarrierspayguestsmallbroughtpagbahingsobrachoiceginagawalansanganhinanakitkasamaangnanonoodnamuhaybakantemaghihintaymilyonghahatoldeliciosapagkalitonagpagupitmanghikayathiwanagmadalingmakatarunganginirapan