Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

2. Nag-aral kami sa library kagabi.

3. Utak biya ang tawag sa mahina ang pag iisip

4. Wala yun, gusto ko rin naman sanang pumunta dito eh.

5. Tahimik ang buong bahay, waring walang tao sa loob.

6. Libro ko ang kulay itim na libro.

7. The power of a single act of kindness can be immeasurable in its impact.

8. Software er også en vigtig del af teknologi

9. Pakibigay ng oras para makapagpahinga ang iyong sarili.

10. Ang mga hudyat ay maaaring maging bahagi ng kultura at lipunan, na may iba't ibang kahulugan sa iba't ibang konteksto.

11.

12. Mas mainit sa Pilipinas kaysa dito.

13. Sa edad na 35, si Rizal ay pinatay sa pamamagitan ng pagsasalang ng baril sa Luneta Park noong Disyembre 30, 1896.

14. Ano ang sukat ng paa ni Elena?

15. Ang bola ay gumulong pababa sa hagdan.

16. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

17. Nasira ang kanyang sasakyan dahil sa isang aksidente sa kalsada.

18. Inflation kann auch durch externe Faktoren wie Naturkatastrophen verursacht werden.

19. Hindi dapat natin kalimutan ang kabutihang loob sa mga taong nangangailangan, samakatuwid.

20. May konsyerto sa plasa mamayang gabi.

21. Hanggang kailan mo ako girlfriend? diretsahang sabi ko.

22. Magdamag kong naiwang bukas ang ilaw.

23. I am exercising at the gym.

24. Sa paghahanap ng solusyon sa mga palaisipan, mahalaga ang tamang pag-iisip, pag-aaral, at eksperimentasyon.

25. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

26. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

27. Ang mahagway na katawan ni Kablan ay naging mahabang isda na may matulis na nguso at matatalim na ngiping parang kakain kaninuman.

28. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

29. Lügen haben kurze Beine.

30. Ang mga bulaklak sa mesa ay nagbigay ng mabangong ambiance sa hapag-kainan.

31. Sa brainly ako madalas nakakakuha ng ideya.

32. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

33. Ano ang pinapanood mo sa telebisyon?

34. Nagdadasal ang mga residente para sa ulan upang matapos na ang tagtuyot.

35. Ngunit hindi inaasahang ang dadalaw pala sa kanya ay ang kanyang ama

36. Binilhan ni Fidel ng bulaklak si Imelda.

37. Ignorar nuestra conciencia puede llevar a sentimientos de arrepentimiento y remordimiento.

38. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

39. Ano na nga ho ang pamagat ng palabas ninyo?

40. Ang pagdidilim ng aking paningin ay nagpahiwatig ng pagdating ng masamang panahon.

41. Nació en Caprese, Italia, en 1475.

42. Sasagot na sana ako ng 'oo' ng...

43. Las hierbas de té, como la manzanilla y la melisa, son excelentes para calmar los nervios.

44. The pretty lady in the park was surrounded by admirers.

45. Maghapon nang nag computer ang kanyang anak.

46. Umabot sa hukuman ang panaghoy ng mga biktima ng kalamidad para humingi ng hustisya.

47. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

48. Mahalaga ang papel ng mga organisasyon ng anak-pawis sa pagtitiyak ng kanilang mga karapatan.

49. Si Sarah ay mahusay sa pagtugtog ng gitara, datapwat hindi siya marunong mag-awit.

50. Ang mga anak-pawis ay nangangailangan ng mas mataas na antas ng edukasyon upang umangat sa kanilang kalagayan.

Similar Words

High-definitionhighest

Recent Searches

layuninhighbuladaratingsnaparkepag-aapuhapnaminfitnesskuninsesamepasannanlilimahidreservesmaliwanagnagdadasalnarinigkalakihannakaliliyongmaibigaybalatpapasaniyangpinakainbakemalapitnakakainlagnatetsydamingnasarapanbayabasinfluentialfacebooksisipainpamagatmagpuntayeaheditberkeleybilingpasensiyapagbabagong-anyonakaramdamnagkwentopagtataposlumiwagkapangyarihangnakakagalanagpipiknikpinakamatapatkasaganaanhinipan-hipanhumalakhakkainmagsunognami-misspakakatandaanpinapataposarmednagdiretsomagkaharapkapasyahankumikilospinaghatidanemocionantenangangaralnakitulogtumigilpaospabulongfysik,pinabulaansugatangbalikatnabigyane-bookspapuntangkababalaghangakmanginiirognabigkasdireksyonna-curioussinisipinoykutsaritanghinukaypulgadaadvertisingkaragatanmadalingmaghintayjagiyaumibiganilaumiisodnapatinginmaaariyourself,susulitcnicokulaykasakithikingaddictionskyldesbiyasrestawranpag-alagawellcomplicatedsusunduingalitespadaouemakikiniglinggomeaningmadurassumayatinitirhanreturneddinanasnanghahapdiparingmagpahabasementeryosinipangeventshearisaacbranchadversecesfaulthalagamacadamiatandaservicespracticesestablishedumarawlikelysafe1876tabamaramiairplanessusundoopportunitykumakainsciencekausapinakinkaniyanglagingtodasbilhinpagtatanongminamahalsasabihinerlindapinakamahabarailparinakasuotadoboiyakkenjisakimanumanmaubosexistmastertechnologyworkingroughnagandahanpamburamakakatakasnatanggappare-parehokumukuhamanirahanpananglawnangangakonapasubsobalaaladisfrutarnakapasokaplicacionestinakasansaktansiopaomagisipginawanggitanasmapaggression