Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Sa pagpupulong ng mga pulitiko, inilahad nila ang kanilang mga mungkahi upang maisulong ang mga batas at polisiya.

2. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

3. OMG. Makalaglag-panty si Kuya!!

4. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

5. Seguir nuestra conciencia puede requerir coraje y valentía.

6. Las suturas se utilizan para cerrar heridas grandes o profundas.

7. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

8. Uuwi si Ellen sa Cebu sa Pasko.

9. La música clásica es una forma de música que ha existido durante siglos.

10. Hindi natin dapat husgahan ang mga tao base sa kanilang kababawan dahil maaaring mayroon silang malalim na dahilan.

11. Maramot siyang magpahiram ng kanyang mga libro dahil takot siyang masira ang mga ito.

12. Ang nakapagngangalit, unti-unti na namang nalalagas ang kaniyang buhok.

13. Pneumonia can be life-threatening if not treated promptly.

14. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

15. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

16. Nang magbago ang mga pangyayari at matanggap ko ang mga kaganapang hindi ko inaasahan, ang aking pagkabahala ay napawi.

17. Sikat ang mga Pinoy vloggers dahil sa kanilang creativity at humor.

18. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

19. Ang banal na kumbento ang naging tahanan ng mga sakristan.

20. Det er vigtigt for samfundet at arbejde på at inkludere og respektere transkønnede personers rettigheder og behov.

21. Kung may gusot, may lulutang na buhok.

22. Napatingin ako sa may likod ko.

23. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

24. The dog barks at strangers.

25. Gumagawa ng tinapay si Tito Mark sa kusina.

26. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

27. Magkamali ka, hindi makakatakas sa kanilang mga mata.

28. Mahirap kalabanin ang sakit na nagdadala ng agaw-buhay na pakikibaka.

29. There's no place like home.

30. Ang pogi ng BF mo Maria, sana-all!

31. Anong panghimagas ang gusto nila?

32. Sasambulat na ang nakabibinging tawanan.

33. Aray! Bakit mo ako sinapak! Potaena mo naman!

34. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

35. Sa pamamagitan ng kalayaan, malaya tayong magpahayag ng ating mga opinyon at paniniwala.

36. Napakaganda ng mga pasyalan sa bansang Japan.

37. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

38. Nasaktan, nagalit din ang lola at gumanti.

39. We need to reassess the value of our acquired assets.

40. Iyong pakakatandaan na ikaw lamang ang aking iniibig.

41. Las escuelas también pueden ser religiosas o seculares.

42. Mahigit sa pitong libo ang isla sa Pilipinas.

43. Napapalibutan ako ng poot habang pinagmamasdan ko ang mga taong nagtataksil sa akin.

44. Kumusta ang bakasyon mo?

45. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

46. Ang pagiging malilimutin ni Ana ay laging nagdadala ng problema sa kanilang grupo.

47. She has been baking cookies all day.

48. Lazada has a strong focus on customer service and has won awards for its efforts.

49. Saan ako nag-aaral ng kindergarten?

50. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

Similar Words

High-definitionhighest

Recent Searches

highsakayinispnakakatakotsong-writingtubig-ulankaygitnabakuranalituntuninmabangongenergifotosteknolohiyamagta-trabahokapagbinyagang00ampaladpusatheydumikitfirstlungsodbalahibopatidragontinungokanayonpanalanginsapagkattamadyarisandokbagkus,increasinglysamahannapahintomamayasilasinumanlagaslasdawauthorakongtulunganpilipinostapleimulattindigdapatmasayang-masayainternetpowerlasakasikalayaannuevosmatutulogopomaglutoimpactpintuanpangalantubigmagkasamasubject,busilaklibanganmaasahancanadarizaltindanutrientesmataaskotsefarmkuwentoparapetsangkangkongmanghuliisa-isapagdiriwangadvancementkinakitaanpisaraanilahattunaypag-aapuhapsuchkumantakahilingansiguromagsasamamanonoodanak-pawishalipdiyanprobinsyatumalonhinugottonomaduronobelamaramingmungkahibukastilalakadmapahamakkarwahengiyonkabutihannakangisipilipinashimutokapatnapuhalakhaktolomkringhimigbakatag-arawgumagawapag-asapresidentethinkdogssundhedspleje,akmaipakitasagotmabangismariansimbahannaroonharapinbirohuwebessumagotnaghihinagpiskauntiinisnapakaramingregalodagligejejuuniversetcarsnanamanrawkalaunannalalabimariangbumalingmahabolpondomallbarkohardinpunomoviesmumomuraisdananaogninapilingbulongkitang-kitabiglaedukasyoniwanilawparkepaskodiyaryonaglokohanmaliitbigyanikawnamingmagiting18thnakangitingkutowikakumakapalrelativelykumunotpagpalitkumbentomagbigaycaracterizaoraspedengmabangomasaya