Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang pagpapahalaga sa ating kalikasan ay mahalaga para sa kinabukasan ng susunod na henerasyon, samakatuwid.

2. Les préparatifs du mariage sont en cours.

3. La deforestación es la pérdida de árboles y plantas en los bosques debido a la tala indiscriminada.

4. Lumayo siya sa amin, waring nais niyang mapag-isa.

5. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

6. The children play in the playground.

7. Mabait ang pamilya ni Aling Juana kaya panatag ang loob ng ama't ina ni Bereti.

8. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

9. El trigo es uno de los cultivos más importantes a nivel mundial para la producción de harina.

10. Si Rizal ay kilala bilang isang makata, manunulat, pintor, doktor, at lider sa paglaban sa kolonyalismong Espanyol.

11. "Tuloy po kayo," ani ng matanda sa bisita niyang dumating.

12. Naiwan ko ang mga kubyertos sa bahay kaya nagdala ako ng disposable na kutsara at tinidor.

13. Sa buwan ng Mayo ang kaarawan ko.

14. Mabuti pang makatulog na.

15. Anong wala! pasinghal na sabi ni Aling Marta

16. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

17. Sa mga matatandang gusali, naglipana ang mga alamat at mga kuwento ng nakaraan.

18. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

19. Alas-tres kinse na ng hapon.

20. A couple of raindrops fell on my face as I walked outside.

21. Hindi ko mapigilan ang puso ko na tumibok kapag nakikita kita. Crush kita talaga.

22. Pangarap ko ang makasakay sa eroplano.

23. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

24. Dalawampu't walong taong gulang si Paula.

25. Hindi ko kayang magpanggap dahil ayokong maging isang taong nagpaplastikan.

26. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

27. Esta comida está bien condimentada, tiene un buen nivel de picante.

28. Hindi dapat supilin ng mga magulang ang mga pangarap ng kanilang mga anak.

29. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

30. Ang parusang angkop sa suwail na anak ay iginawad.

31. La tos crónica puede ser un síntoma de enfermedades como la bronquitis crónica y la enfermedad pulmonar obstructiva crónica (EPOC).

32. Nasa ganito siyang kalagayan nang bigla niyang maramdaman ang isang ubos-lakas na sipa sa kanyang pigi.

33. Sunud-sunod na nakatalungko ang mga ito sa isa pang bangkong nas atagiliran ng nanggigimalmal na mesang kainan.

34. He was a pioneer in martial arts and fitness and his teachings are still relevant today

35. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

36. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

37. Facebook Marketplace is a platform where users can buy and sell items locally.

38. Ang ganda naman nya, sana-all!

39. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

40. Les enseignants peuvent adapter leur enseignement en fonction des besoins et des niveaux de compréhension des élèves.

41. Debemos tener una buena comprensión de la realidad para tomar decisiones informadas.

42. Sa dapit-hapon, masarap mag-meditate at mag-isip-isip sa mga bagay-bagay.

43. Sige, tatawag na lang ako mamaya pag pauwi na ko..

44. Mahusay mag drawing si John.

45. Mahilig siya sa pagluluto, datapwat madalas ay hindi niya nasusunod ang tamang recipe.

46. Habang wala pang trabaho ay matuto kang magtiis na asin ang ulam.

47. Sino-sino ang mga nagsibili ng mga libro?

48. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

49. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

50. She has just left the office.

Similar Words

High-definitionhighest

Recent Searches

dependingmauboshighdulaimpithulusilaamosemillasatenakahainbeintenabighanivenusbarrerasbingbinggatassugatangsinimulanedukasyonnocheanibilanginpinisillumiitpocaibilinogensindetamarawmarchpagbigyanlarobotanteochandobagkusheartbreakkingdomgulatblazingpaksalalaaywanallottedartsnagpagupitmakahingilaybrarithankpinauwigospelnagwelgashadesniyonnapanoodpunongkahoyinuulamkalagayanlumbaydependbisitajokenagbakasyoniyanligaligpublishing,tumakasemocionalfranciscoflamencodangeroustransparentkinatatakutankuliglignakitulogmakikiraanlandobibigyanmatanguugod-ugodskyldessaglitbototrentafulfillmentshortnagmakaawainiangatcommunicationsnapakasipagkabangisanroughtshirtnothingprovidedmediumunconstitutionalmatabamanamis-namispagsayadumiiyakmagsalitaberkeleypagkakalutosiglofe-facebookeksaytedtomtiketeditoverviewmessageikinalulungkotincitamentererrors,nagbasatechnologydoestanodtinungoe-explainvirksomheder,delesantosprotestabertokagandahagtwinklepaghuhugasmakikitulognakapagreklamoanubayansecarselansangannakalagaysabongkinahuhumalinganhitsuraclipmakuhaprotegidoramdamsumalakayeksenatransmitidasiniisipunabadingtechnologicalemnerisinaraorganizehawakspeedbritishpagsubokgamemagulayawbatisawanagbibiropalaisipanmawawalalalimbarung-barongnasuklamtrafficdarkmaipantawid-gutompadabogsumasayawnilulonmarsokontinentengnanlalamigparaangpaglalayagpitakaagaw-buhaypinabayaansocietyteknologihouseholdbasketballpakikipagtagpoarabiaoktubreactualidadrepublicanculturemalezapaninigassellkawayanperangwatawatbasketbolsangadistanciadiliginlinggong