Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. They have planted a vegetable garden.

2. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

3. Mawala ka sa 'king piling.

4. Las hierbas silvestres crecen de forma natural en el campo y se pueden utilizar en infusiones.

5. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

6. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

7. Hindi ko alam kung may chance ako, pero sana pwede ba kitang mahalin?

8. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

9. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

10. Sa bawat tunog ng kundiman, nararamdaman ang lambing at sakit ng pusong umiibig.

11. Nais sanang magbago ng isip si Magda, ngunit nanaig ang kanyang pagkagusto kay Damaso.

12. Napatingin ako sa menu. Parang nagc-crave ako sa hotdog.

13. Oo nga babes, kami na lang bahala..

14. May isang umaga na tayo'y magsasama.

15. Einstein was offered the presidency of Israel in 1952, but declined the offer.

16.

17. Napadungaw ang ina at kitang-kita niya ang pagkasubasob ng anak bago paman ito nakaakyat ng hagdan.

18. Ang talambuhay ni Juan Luna ay nagpapakita ng kanyang husay at kagalingan bilang isang pintor.

19. Isang bata ang lumapit sa magandang babae at nagbigay ng kapiranggot na makakain.

20. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

21. Nagsimula ang programa sa dakong huli ng gabi.

22. May anim na silya ang hapag-kainan namin.

23. Bakit di mo 'to sinabi sa akin?

24. Las vacaciones de invierno son un momento para descansar y pasar tiempo en familia.

25. La realidad es que las cosas no siempre salen como uno espera.

26. Ang talambuhay ni Juan Ponce Enrile ay nagpapakita ng kanyang malawak na karanasan sa pulitika at pamumuno.

27. Protecting the environment involves balancing the needs of people and the planet.

28. Nagsagawa ng seminar ukol kay Marites sa pangangalaga niya ng kalikasan.

29. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

30. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao.

31. Mag asawa na kayo pero hindi mo pa nasasabing mahal mo siya?

32. Ang bunga ng kakaibang halaman at tila ba kamay na nag-iimbita.

33. Walang nakakaalam kung saan sila napupunta.

34. Sigurado na siyang walang panalo sa kanya ang matanda.

35. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

36. From: Beast Nasaan ka? Bakit di mo ako hinintay?

37. Hindi ka ba papasok? tanong niya.

38. Ang daming adik sa aming lugar.

39. Congress are elected every two years in a process known as a midterm election

40. Las noticias en línea pueden ser actualizadas en tiempo real.

41. Ang taong lulong sa droga, ay walang pag-asa.

42. Kumain ako ng itlog kaninang umaga.

43. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

44. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

45. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

46. Comer alimentos frescos y no procesados puede ayudar a reducir el riesgo de enfermedades cardíacas y diabetes.

47. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

48. I found a great recipe on a cooking website that I can't wait to try.

49. Ano ang gustong orderin ni Maria?

50. Di mo ba nakikita.

Similar Words

High-definitionhighest

Recent Searches

magingplatformsartificialhighexpectationssimbahanmagbayadkinakabahanpagngitimagpaniwalanapapalibutannagkakasyapanghabambuhaybibisitakonsultasyonmagkakagustomagkasintahannalalaglagnagre-reviewpagkakayakapnakatunghaysundhedspleje,moviesmagkikitaeskuwelahannanlilimahidpanokumakainumakbaypalancatotoongvillagesinaliksikmagsusuotmaliwanaggovernmentkabutihanpinagawanecesarionananalongmasaksihanisasabadsagasaanpamilihanfestivaleshumiwalaynageespadahannapakamotkalayuannakuhangnakangisifulfillingtungonaglutonabuhaymabagalpaninigascombatirlas,damdaminbahagyanagbabalamagdamagmamahalintaosfrancisconakapagproposesay,may-bahayumiisodpakikipaglabanvideosnaglulutoincluirnaiilangmagtakadesisyonanmanilbihanomfattendegownmalawaksementoarabiabibilhinkakayananctricashatinggabiawitinbanalpagsusulitbook,kontrapinalambotmanalogawingmakakasunud-sunodmatutongtanghalimakisuyoniyoneksport,manghuliadvancekahilinganhigh-definitionteachersacrificebuntisedsanogensindepinalayaskasuutanwaiterpusabestidabinibilangsumisilipreynaelenalangkayjoblayuansakimcalidadlihimmariloupinagalitanritocollectionsgabingconsistbuwanginangshopeeblazingsalarindalawamapaibabawalexandertradegrinscelularestilladangtiketmayabangsaykasoasthmaaudienceapoypromotingconsumetracklivepublishingidea:transitvedgameeveningrefersproducirtsaabluedemocraticmarsogreenseektools,jacereducedmasdansumamapostcardbagogitanasmakapilingyeahlutuinjunjunitemscontrolledwaitmaratingbetaconditionedit:debatesappstatinginternaobstaclesschoolnothingtelevisedinilingpartnerteamenforcing