Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang paglutas ng mga palaisipan ay hindi lamang tungkol sa pagpapakita ng kaalaman, kundi tungkol din sa pagpapakita ng kahusayan sa pagpapasya at paglutas ng mga suliranin.

2. Menghabiskan waktu di alam dan menjalani gaya hidup yang sehat dapat meningkatkan perasaan kebahagiaan.

3. Si Mang Ernan naman na isang manunulat, isa ring propesor sa isang unibersidad sa maynilaat nagging kasapirin sa iba't ibang samahan

4. The symptoms of pneumonia include cough, fever, and shortness of breath.

5. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

6. Players move the ball by dribbling, passing, or shooting it towards the basket.

7. The train was delayed, and therefore we had to wait on the platform.

8. Las heridas en zonas sucias o contaminadas pueden aumentar el riesgo de infección y requerir una limpieza más exhaustiva.

9. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

10. Naiilang pa ako sa kanya dahil bago pa lang ako sa pagliligaw, kaya hindi ko alam kung paano siya lapitan.

11. Ang pag-inom ng tsaa tuwing umaga ay isa nang ritwal na nagbibigay ng enerhiya sa kanya.

12. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

13. There are a lot of books on the shelf that I want to read.

14. Andre helte er stille helte, der arbejder i skyggerne.

15. The chest x-ray showed signs of pneumonia in the left lung.

16. Dahil ika-50 anibersaryo nila.

17. La realidad puede ser sorprendente y hermosa al mismo tiempo.

18. Dalawampu't walong taong gulang si Paula.

19. Kapag nalulong ka na sa droga, mahirap nang makalaya sa hawla nito.

20. Banyak jalan menuju Roma.

21. Na-curious ako kaya't nag-google na lang ako upang malaman ang sagot.

22. Ha? Ano yung last na sinabi mo? May binulong ka eh.

23. Ang lahat ng taong napapadaan sa nasabing puno'y napapahinto dahil sa dami ng bungang nakasabit sa mga sanga.

24. Hinanap niya si Pinang.

25. A picture is worth 1000 words

26. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

27. Børns leg og kreativitet er en vigtig del af deres udvikling.

28. Naaalala mo pa ba noong tayo pang dalawa.

29. The patient was discharged from the hospital after recovering from pneumonia.

30. Inutusan ng guro ang mga estudyante na ipunin ang lahat ng bola sa silid.

31. Lumaki si Ranay na ang trabaho ay kumain at ang libangan ay kumain parin.

32. Nakumbinsi niya ang mga ibon at siya ay isinama sa kanilang pagdiriwang.

33. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

34.

35. Samantala sa trabaho, patuloy siyang nagpapakasipag at nagsusumikap para sa kanyang pamilya.

36. Mon mari et moi sommes mariés depuis 10 ans.

37. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

38. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

39. The guilty verdict was handed down to the culprit in the embezzlement trial.

40. Sa mga lugar na may tag-ulan, kadalasang mas madalas magkasakit ang mga tao dahil sa mas mabilis na pagkalat ng mga sakit sa panahon ng malakas na ulan.

41. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

42. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

43. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

44. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

45. Sa gitna ng unos, ang kanilang mga panaghoy ay dinig hanggang sa kabilang baryo.

46. Gusto mo ba ng isa pang tasa ng kape?

47. Mababaw ang swimming pool sa hotel.

48. There's no place like home.

49. Pumupunta siya sa Maynila bawat buwan.

50. Handa ko pong gawin ang lahat para lang tuparin Mo po ang aking kahilingan.

Similar Words

High-definitionhighest

Recent Searches

advancedinuminnilutothereforestageputipasswordhighlackchangenagsimulanapakasipagmanghikayatplanning,palantandaanreducedallowedpracticespeterbaberoqueanimhimigrobertcountlessdooneffectsadaptabilityinfinityevolvebituinpublishedtoolknowclassmatetechnologicalpinunitnapadamipandemyatomorrowmakausapbilingdalawampunakataaslamesahumpaypnilitmasaganangkalalakihannagbanggaanbabayaranhalikamaskaranagtagisannapapalibutanpagtutolpanalanginpagkatlangitsumasayawnatawanagnakawmateryalesbaoinstitucionessigaimpitsalbahephilippinepakinabangantusindvisnakasinimulaniatfedadbumisitaradyofavornanaynahihiyangmasinopomelettemasdansatisfactionquicklysolpamilihannagkakatipun-tipondistansyamakalaglag-pantypinakamahalagangikinamatayikinasasabikmoviesnagngangalangnagagandahanmagsi-skiinghubad-baronapaluhanakahigangmatapobrengmakatarungangtig-bebenteinasikasoaktibistakahilinganmaisusuotnagwagipinagawapaanongtungawsulyapnakaraanpakakatandaanemocionantebalediktoryantumiramakakabalikyumabangprodujotumawapamumunokaklasemasasayalitsonpaninigaskampeonpakiramdamthanksgivingnaaksidentenatatawaautomatisktuktoknaglokohannatutuwakaraokepamahalaantahimiknapawinatatanawamuyinisasamatumingalasteamshipsdisensyotinatanongnakahugnagwikangpneumonianakapikitsiguromusicalhinagisgatolnatitirangforskelrolandangelagreatlydealkamalayanvelfungerendesakayakongmagnifypebrerowasakpagputimaongsalesnaisdesarrollarninyopersistent,sangboracaylossbangkopaskongchooseinantaypresyovampiresrhythmnooawaipinadalawaynyajokelabasproblemapanguloinalokbelievedcafeteriabinabalikpakpaktenmaaring