Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

2. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

3. Samahan mo muna ako kahit saglit.

4. Twinkle, twinkle, little star.

5. Kinuha nya yung wallet nya at inabot yung bayad.

6. Ang malalakas na tama ng kidlat ay binulabog ang langit at nagdulot ng takot sa mga tao.

7. Ang mga botanista ay nagtatanim ng mga endemikong halaman sa mga pook kagubatan.

8. Sa malamig ngunit maliwanag nang sikat ng araw, nakikita na niya ang langkay ng mga agwador.

9. Gusto ko nang kumain, datapwat wala pa akong pera.

10. Tumingala siya ngunit siya'y nasilaw.

11. Emphasis can be used to create a sense of drama or suspense.

12. Sinikap niyang kumbinsihin ang mga katutubo upang maging Katoliko.

13. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

14. The children play in the playground.

15. Kapag may isinuksok, may madudukot.

16. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

17. Mathematics can be used to model real-world situations and make predictions.

18. Scientific data has helped to shape policies related to public health and safety.

19. Les maladies chroniques telles que l'asthme, l'arthrite et le syndrome de fatigue chronique peuvent affecter la qualité de vie d'une personne.

20. Magandang umaga po. ani Maico.

21. Las hojas de té son muy saludables y contienen antioxidantes.

22. Makapangyarihan ang salita.

23. Gusto ng mga batang maglaro sa parke.

24. Sa edad na 35, si Rizal ay pinatay sa pamamagitan ng pagsasalang ng baril sa Luneta Park noong Disyembre 30, 1896.

25. Itinali ng hari ang batang higante at pinakawalan ang mga taong nakakulong sa kuweba.

26. Puwede siyang uminom ng juice.

27. Bitbit ng isang kamay ang isang pangnang sisidlan ng kanyang pamimilhing uulamin.

28. Natapakan ako ni Juliet habang sumasayaw.

29. Ngunit hindi napigilan si Magda ng kanyang mga anak.

30. Masasabi ko na ang mga kanta ng Bukas Palad ay nagbibigay sa akin ng kapayapaan at kapanatagan.

31. Nagpunta sa kumbento si Sister Jane.

32. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

33. Sa paglalakad sa gubat, minsan niya ring naisip na masarap maglakad nang nag-iisa.

34. Lagi na siyang tulala, hindi na siya halos nakakapasok sa paaralan at lagi lang siyang nasa simbaha't nagdarasal.

35. Nagpabakuna kana ba?

36. Isang araw naglalakad si Ipong papuntang piging ng may bigla siyang nakasalubong na babaeng humihingi ng limos.

37. Magalang na hiniling niya ang tulong ng guro sa kanyang takdang aralin.

38. La música puede ser una forma de protesta y expresión de descontento.

39. Gusto ko sana na malaman mo na pwede ba kitang mahalin?

40. Hindi naman natuwa ang mga estudyante sa pagkakaroon ng reshuffling dahil kailangan nilang lumipat ng silid-aralan at mag-adjust ulit sa kanilang mga kaklase.

41. Biglaan siyang nagsalita nang hindi ko inaasahan na magkakaroon siya ng ganung opinyon.

42. Ang pagkakalugmok sa pag-aakala ng mga kasinungalingan ay nagpapakita ng pagiging bulag sa katotohanan.

43. We were trying to keep our engagement a secret, but someone let the cat out of the bag on social media.

44. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

45. Puwedeng gamitin ang pagguhit upang magpahayag ng mga saloobin at mensahe sa mga taong mahal mo.

46. Ang pagkakaroon ng malubhang karamdaman ay nagdulot ng malalim na lungkot sa aming pamilya.

47. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

48. Ako ang mas nagulat nang hapasin ni Maico sa hita si Mica.

49. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

50. Nakaramdam siya ng pagkainis.

Similar Words

High-definitionhighest

Recent Searches

highwayschecksplaysstrengthmapadalihalikaareareadformstutorialswindowdumaramiinitleadtechnologystyrerlibropointpantalongnagkantahanutusankisshapasinestasyonlapisengkantadanagpapaigibclubkuwintassighabanganfysik,paosbinge-watchingnakisakayallottedguidancemalabobukodiniirogprotegidobunutanaffiliatemuycomputere,kinantajeromecupidsuotkaninakasitechnologicalkaawaytekstoperatemacadamiaeksenamatutulogtargetbaldecescelularespolvoschavithanapbuhaypinalitanriquezabadingestablishednotebookmaglarotsupernagbibigaykuwebamang-aawituugod-ugodmainitpakpaktinaasanmangprodujofearolatagaytaypagtungointindihinnavigationkakilalamagdaankahaponsalesmagbasamagnifypakealamwerepancitletterbabaliksolarconvertingmagpagalingnakuhangtig-bebenteinirapansakristanalikabukintuluyannagsunuranmahahanayfilmmaestronapakahusaymagbagong-anyokadalagahangpagka-maktolikinamataykonsentrasyonsinungalingsulyapsasabihinmanghikayatemocionantedeliciosanapanoodlumikhaentranceisulatmaliksimakabilileadersnakauwipresidentelumakasnapakalusogi-rechargepinasalamatanpambahaymaanghangumagawyumabangtumawatahimikninanaiskalabawnapalitangnasasalinanengkantadangpundidonasaangmaghaponhinahanapbulalasnagbibirovaccineskilongpisngimay-bahaypansinbuhawikoreaeksport,nabigaysakenmatumalawitannasilawpinapakinggankasamaangnangingilidlumbaydakilangunconventionaleconomicrightsgusalimaskarabahagyangbenefitsmarilourecibirsisipainbesescocktailmasukolsarongretirarmukhalabahinumakyatinteligentesyamannagbabagaherundermakulitsocialericomonumentomagbubukidtinuro