Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang sobrang pangamba ay maaaring magdulot ng kakulangan sa kumpyansa sa sarili.

2. Sino-sino ang mga kakuwentuhan mo sa klase?

3. Ang mga magsasaka sa kanayunan ay nag-aapuhap ng suporta mula sa gobyerno para sa kanilang mga pananim.

4. Kailangan ko ng lumisan mahal ko.

5. Gusto ko lumabas pero malakas pa ang ulan.

6. The credit card statement showed unauthorized charges, so I reported it to the bank.

7. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

8. Sa tulong ng mapa, natukoy namin ang pinakamabilis na ruta patungo sa beach.

9. Hindi siya maramot sa pagbibigay ng kanyang mga lumang damit sa mga nangangailangan.

10. Pakibigay ng pagkakataon ang lahat na makapagsalita sa pulong.

11. Binalita ng magkasintahan ang kanilang kasal at ang nakatakdang araw ng pamamamanhikan.

12. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

13. May lagnat, sipon at ubo si Maria.

14. Sa katagalan, natanggap na niya ang panunuksong ito.

15. At have håb om en bedre fremtid kan give os troen på, at tingene vil blive bedre.

16. Sus gritos están llamando la atención de todos.

17. They are not singing a song.

18. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

19. Ang mga natatanging likhang-sining ay dapat na itinuring bilang mga obra ng kahusayan at katalinuhan ng mga artistang naglikha.

20. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

21. Nagbigay ng kanyang opinyon ang eksperto ukol kay President Bongbong Marcos

22. Kapag nagkakaroon ng sakuna, ang mga volunteer ay nagiigib ng tubig para sa mga apektadong pamilya.

23. Hendes hår er som silke. (Her hair is like silk.)

24. Ang pagkakalugmok sa pag-aakala ng mga kasinungalingan ay nagpapakita ng pagiging bulag sa katotohanan.

25. Maglalaro nang maglalaro.

26. Iiwan lang kita pag sinabi mong iwanan na kita..

27. ¿Dónde está el baño?

28. El curry tiene un sabor picante y aromático que me encanta.

29. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

30. Limitations can impact one's career, relationships, and overall quality of life.

31. Las escuelas tienen una política de tolerancia cero para el acoso escolar.

32. Kailangan kong tapusin ang ginagawa ko.

33. I am writing a letter to my friend.

34. Ano ang pinabili niya sa nanay niya?

35. Kasingganda ng rosas ang orkidyas.

36. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

37. Ano bang nangyari? tanong ni Lana.

38. Have we seen this movie before?

39. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

40. Susunduin ako ng van ng 6:00am.

41. Masdan mo ang aking mata.

42. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

43. Te llamaré esta noche para saber cómo estás, cuídate mucho mientras tanto.

44. Ang buhangin sa tabing-dagat ay nagbabaga sa init ng araw kaya’t mahirap itong apakan.

45. Gusto ko sanang makabili ng bahay.

46. Trenta pesos ang pamasahe mula dito

47. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

48. Gumagawa ng tinapay si Tito Mark sa kusina.

49. Sa lugar na ito, naglipana ang mga prutas na hindi pangkaraniwan sa ibang lugar.

50. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

Similar Words

High-definitionhighest

Recent Searches

mind:metodehighstudiedspeechpreviouslyclearlightstomstandeksamaidlabananalinferrerwaysimagingipinaconsideraronelcdpopulationrolledgraberolelastingincreasinglyochandopapuntastudentseducationalyourteamadditionallyvariousinformedkartontabadifferentdumaramicontrolaemphasizedgapoftenkasingquicklyexplainpacereturnedbilingflashincreasesspreadlasingcallingheftyabanganamountincreasebetaryaninteligenteslargemakingseparationtermmenufrogconsidergenerabatechnologieswhichmultouniquehellobasahulinginternacontentcircletimeconstantlyideyaareanagugutomprincipalespagkakakawitsandokiyakbosseducationsorpresainfluencebayaniawitvivamisahintuturoniyangmovingglobalbagsakkumaripassinabingpaderminabutiinitninanaismaabotnagkalapitpinipilitskillsnagkikitatumubokaninongexcitednag-bookkalikasanmatangumpaydisfrutarmakakatakasnag-iinomnagtatampolamigparusanag-aalalangitsurawindowayoncondowinsgelaiifugaogawadatipintodumilatdon'tbangamagisinggawainkungperabanktibiglittlemagandang-magandakasamabarnesmasukolmaalalahayoppesokumustapagka-datupagtatapospanahonipinalutobabakonsultasyonimpactjuanitoayawbasketballbabenakaraangpaglisaninispemocionantebookscomplexhistorymakabawinagcurveabalangkongtahimikmaghandanaglalarotingin1928thoughstartsinikaptinatanongcourttelevisedtinderafriendkasamanghinihintaynaidlipnamingurohandamisteryohumanapdiaperdahonlaman