Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nakita ko sa facebook ang dati kong kaklase.

2. Las compras en línea son una forma popular de adquirir bienes y servicios.

3. The heavy traffic on the highway delayed my trip by an hour.

4. The project was behind schedule, and therefore extra resources were allocated.

5. Disente naman talaga ang kanilang pamilya.

6. Pinagbubuksan ko ang mga bintana.

7. Gusto kong maging maligaya ka.

8. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

9. Sa panahon ng digmaan, madalas masira ang imprastraktura at mga kabuhayan ng mga tao.

10. Gumawa ng pangit na drowing ang kaibigan ko.

11. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

12. Nakatawag ng pansin ang masama nitong amoy.

13. Tangan ang sinipang pigi, ang buong anyo ng nakaangat niyang mukha'y larawan ng matinding sakit.

14. Les patients peuvent bénéficier de programmes de réadaptation pendant leur hospitalisation.

15. Busy pa ako sa pag-aaral.

16. La lluvia produjo un aumento en el caudal del río que inundó la ciudad.

17. Ano ang alagang hayop ng kapatid mo?

18. Einstein's legacy continues to inspire and influence scientific research today.

19. Sumasakit na ang kanyang sikmura dahil hindi pa rin sya kumakain simula kaninang umaga.

20. Ang mga marahas na eksena sa mga pelikula ay maaaring magkaruon ng masamang impluwensya sa mga manonood.

21. Maarte siya sa kanyang pagpili ng libro kaya halos lahat ng kanyang binabasa ay mga klasikong nobela.

22. Oo. Gusto ko na lang sana talaga makauwi. sagot ko.

23. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

24. Inaamin ko rin na kulang ang aking nalalaman.

25. Kanina pa kami nagsisihan dito.

26. Guten Abend! - Good evening!

27. Sa bawat desisyon na ating ginagawa, kailangan nating isaalang-alang ang bawat posibilidad, samakatuwid.

28. Paano tayo? Di mo pa sinasagot yung tanong ko. aniya.

29. El agua es esencial para la vida en la Tierra.

30. Ang problema niya nga lang ay sadyang malayo ang paaralan sa palasyo kaya kinausap niya si Helena tungkol sa bagay na iyon.

31. Nagwelga sina Ka Leo laban sa pamahalaan.

32. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

33. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

34. Las drogas pueden tener efectos devastadores en la vida de las personas.

35. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

36. Eh ayoko nga eh, sundae lang talaga gusto ko.

37. Les enseignants jouent un rôle important dans la réussite des étudiants.

38. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

39. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

40. Nasa ibabaw ng mesa ang bag ni Clara.

41. Eine Inflation kann auch durch den Anstieg der Rohstoffpreise verursacht werden.

42. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

43. Tesla was founded by Elon Musk, JB Straubel, Martin Eberhard, Marc Tarpenning, and Ian Wright.

44. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

45. Les préparatifs du mariage sont en cours.

46. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

47. Sumama ka sa akin!

48. Acts of kindness, no matter how small, contribute to a more charitable world.

49. Eh bakit mo binili para sa kanya yun kung ganun?

50. Iyon ang totoo, sinasabi niya sa sarili.

Similar Words

High-definitionhighest

Recent Searches

highagesposterhacerhamaknagmamaktolkutsilyopanunuksotaga-nayonnakataasonlinebasurapangkatdireksyonmensahehumintostreettagtuyotnagtataasnobodyupuanenergy-coalnagpatuloynagpasensiyalandaspananimdilabunutanmagbibiyahenapag-alamannagdaantookalongsakalinglastingpanguloninasinapitipinabalotsoftwareomfattendebasahinpagkakalapatguropracticesmbricospayongpisiconectanunidosmagturoobra-maestrapalayopaghamakkuwentogamepag-aalalamabaitkupasingvideos,kamaauditibabainhalebinibiyayaanedwinhumahangositinulosimprovementpinakamaartengilannawalangrabelimangnatigilanmagtatampokelaninasigawiinumindiagnosesnakakatawadooninakalanglugawnagmamadalitinanggapmalimatabalacsamanaharpmadalasnakabaonkatagangmakapanglamangnanagdatapwatlumalakihalinglingtumutuboboypahirapanplanning,tumatawaaraypinapakiramdamannagtinginanpaakyatlaruinmalamangtangingseryosongtinakasanaraw-gandapinabayaanbundokkapangyahirangulatnapilikumaripasisangpapanhiknagbanggaansariliiba-ibangnoonmagagalingtrainingantonioradiokusinafulfillmenttaong-bayanmaabutanmagpapaikotsalu-salomagkaharapmagworkmisteryosongworddatibutituwingnamingkalakipamimilhinuwihumalikumalissamakatwidmorningiwanautomatiskhuminginagkabungademocracyenerobawalipinagbilingsumungawfull-timekabosesmahalwithoutitukodincomerailwayskalupinagcurvedawaksiyonnagdasalnagbabagaibahagitonyomangahaspusakumalmahvordannagpakitamatulisbahaypilinglikodaralpaanongmemoryphysicalnenapananghalianmarvinpanalangincuidado,nagpuntakumalasnaabutanextremistiniresetaextra