Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Malinis na bansa ang bansang Hapon.

2. Hindi siya puwedeng uminom ng beer.

3. Masaya ako tuwing umuulan at kapiling ka.

4. Les hôpitaux peuvent être des environnements stériles pour prévenir la propagation des infections.

5. Si Andres ay pinagpalaluan ng kanyang mga kaibigan dahil sa kanyang tapang at determinasyon.

6. Las rosas rojas son un regalo clásico para el Día de los Enamorados.

7. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

8. Samantalang si Perla naman ay masipag at masinop sa kabuhayan.

9. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

10. Kung may tiyaga, may nilaga.

11. Con permiso ¿Puedo pasar?

12. Mahina ang kita ng kanyang ina sa paglalabada; mahina rin ang kanyang kita sa pag-aagwador.

13. Hindi ka man makahanap ng kasama, mayroon kang kaulayaw sa loob ng puso mo.

14. O sige na nga, diba magkababata kayo ni Lory?

15. Hun er utrolig smuk. (She is incredibly beautiful.)

16. Bago siya ipinatay, si Rizal ay isang aktibistang politikal na lumaban sa korupsiyon at pang-aabuso ng mga Espanyol sa Pilipinas.

17. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

18. La campaña de donación está llamando la atención de la comunidad.

19. Les personnes âgées peuvent avoir des relations affectives et intimes avec leur partenaire.

20. Les hôpitaux peuvent être surchargés en période de crise sanitaire.

21. Hinde ko dala yung cellphone ni Kenji eh.

22. The movie was rated R, and therefore she wasn't allowed to watch it.

23. Ang marahas na paggamit ng lakas ay labag sa etika at pagkamamamayan.

24. También es conocido por la creación de la Capilla Sixtina en el Vaticano.

25. Ipinabalot ko ang pakete sa kapatid ko.

26. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

27. Nakangiting tumango ako sa kanya.

28. No hay mal que por bien no venga.

29. Ano ang sasayawin ng mga bata?

30. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

31. Dumating ang mga kamag-anak ni Fe.

32. Umupo kaya kayong dalawa! sabi sa amin ni Kriska

33. Aku rindu padamu. - I miss you.

34. Marahil ay hindi mo pa nakikita ang bagong pelikulang ito kaya't dapat mo itong abangan.

35. Kakain ako sa kapeterya mamayang tanghali.

36. In 2010, LeBron made a highly publicized move to the Miami Heat in a televised event called "The Decision."

37. El agua es un símbolo de pureza, vida y renovación.

38. Hindi ko na kayang itago ito - may gusto ako sa iyo.

39. Football referees are responsible for enforcing the rules of the game and ensuring player safety.

40. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

41. The grocery store offers a variety of fresh produce, including fruits and vegetables.

42. Mabuti pang makatulog na.

43. Pardon me, but I don't think we've been introduced. May I know your name?

44. Ella yung nakalagay na caller ID.

45. Børn bør lære at tage ansvar for deres handlinger og træffe gode beslutninger.

46. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

47. Ako po si Maico. nakangiting sabi niya.

48. Air tenang menghanyutkan.

49. Emphasis can be used to create a memorable and impactful message.

50. Inakalang hindi siya karapat-dapat, pero siya ang napiling lider.

Similar Words

High-definitionhighest

Recent Searches

highlikehetopagkataposmagtagoilogsaritakumakainimporkaibainakalanglapitanpag-aapuhaptumindigligayahinanapgumantiphilippinenalamankalikasanbrasohalamangnatigilanpitumpongnatalongpag-itimbuslolaborbabeiba-ibangasintirangcosechaslupangpag-alagacausesentry:tag-araworaskatagangpangungusappag-asapayapangpag-iwansearchpag-uwinapakanangingisaylibonggodtpag-aaralmangahaspag-irrigatepopularagwadormagpa-ospitalnakaramdamkumukuhaelepantepagsalakaynagmamadalinagpaalamnagsisigawnagngangalangkalalakihannanghahapdiartistasmeriendaedukasyonhumiwalaypagtutolinsektongpagpanhikmakuhangpinagmamasdanrebolusyonpaglakiiwinasiwasnapatayoumakbaymakabawinagkasakitpagsahodinjurynakabawifitnesspakakatandaanmahinanatanongsenadorharapaninagawcompaniesika-12sugatangabundantebyggetmagpahabamaestrachristmasfavormatutulogsiopaoemocioneslalargahinatidumulannakabiladdiligintmicatagaldakilangmanonoodmasukolpangarappulgadamagsimulabesesmagsaingasawapagpasokanumantatlomauntogsementomaramotsurroundingsmayabongyoutubemaayosiyakthroatminamasdankinakendimatutongdeterioratedissedegreesnakatitiggermanyyunsoundnakasumasakitsandaliartepinagkasundokasaltiniknatulogtapehverlandebansangrevolutionizedwalongparangpriestdikyamoutlinenakasuotomeletteultimatelypeepshopeebeginningsonlinesuccesstransmitsremainaudio-visuallypinalutoideyaelectionsbiggestknowsbluebosspakelamrestawanganitokonekfriespossiblechefprofessionaltheirmalimitkasinggandafloorfinishednamilipitpingganipinalitmethods1982existinfinityjunio