Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Gumagawa ng cake si Bb. Echave.

2. Binilhan ko ng kurbata ang tatay ko.

3. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

4. Dahan-dahang pumapatak ang gabi at unti-unting nagdidilim ang mga kalye sa paligid.

5.

6. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

7. Paki-bukas ang bintana kasi mainit.

8. Sa tamis na dulot ng pag-ibig natin dalawa.

9. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

10. Emphasis is often used in advertising and marketing to draw attention to products or services.

11. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

12. Investing can be a long-term strategy for building wealth and achieving financial goals.

13. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

14. In recent years, television technology has continued to evolve and improve

15. Nakatingin sa araw, humakbang siya upang kunin ang pingga ngunit sa paghakbang na iyon, bigla siyang pinatid ni Ogor.

16. Tila nagtatampo siya dahil hindi mo siya kinausap kanina.

17. Ang hilig mong mang hiram ng gamit tapos di mo naman binabalik!

18. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

19. Argh. Parang batang bading naman eh. Anubayan.

20. Isa sa tatlong magagandang magkakapatid si Psyche.

21. It’s risky to rely solely on one source of income.

22. Ang paggamit ng droga ay hindi lamang nanganganib sa iyong buhay, kundi pati na rin sa buhay ng mga mahal mo sa buhay.

23. Bawal magpakalat ng mga paninira sa kapwa dahil ito ay labag sa moralidad at etika.

24. Nabigla ako sa tanong nya kaya sinapak ko sya.

25. The website's loading speed is fast, which improves user experience and reduces bounce rates.

26. Nagpapantal ka pag nakainom remember?

27. Isang araw sa kanyang pamamasyal ay may nakilala siyang isang bagong mukha.

28. In der Kürze liegt die Würze.

29. El arte puede ser utilizado para fines políticos o sociales.

30. Ang haba na nang bigote mo, mag ahit ka nga!

31. The internet is full of fashion blogs. They're a dime a dozen.

32. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

33. Anong nangyari sa iyo? Bakit ang tagal mong nawala?

34. Ilang gabi pa nga lang.

35. Ikaw na nga lang, hindi pa ako nagugutom eh.

36. Gelai, siya si Tito Maico. sabi ko sabay turo kay Maico.

37. Kaninong payong ang dilaw na payong?

38. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

39. Nagtago kami sa lilim ng malaking bato habang naghihintay sa pagtatapos ng ulan.

40. Ang kamalayan sa kanyang pangalan at nagawa ay naging inspirasyon para sa maraming henerasyon ng mga Pilipino.

41. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

42. Walang bagay na di makita at agad tinatanong ang kanyang ina.

43. El nacimiento de un hijo trae consigo responsabilidades y la necesidad de cuidado y protección.

44. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

45. Magkano ang bili mo sa iyong cellphone?

46. Some limitations can be temporary, while others may be permanent.

47. The chef created a series of dishes, showcasing different flavors and textures.

48. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

49. Money can be saved and invested to achieve financial goals and build wealth.

50. Totoo nga! Sa ilalim niyon nakabaon ang gong na susi ng kanilang kasaganaan.

Similar Words

High-definitionhighest

Recent Searches

metodehighbulaoverviewmapapavarioustargettabicolourhelpfulrepresentativegitarauloexplainspreadremotecompletescalenamamayatpangyayariibamag-alalaisasabadiguhitnasasakupanmasipaghumayoandrewikukumparapagiisippagpapasakitmadilimsandalingkontrabagkustirahanrewardingsinakopkasuutanemnerawardcreationnakaakyatexhaustionkinagigiliwangkarwahengthankshubadpamilihankamaobeautifulkumirotsakalingmassachusettsindustriyamakipagkaibiganmakawalamanilbihanminatamisgovernmentsections,pinangkailanmanmalilimutinlintateacherstonehamdahonpoliticaltsaajeromebalemeetdamitestablishmegethastagrowthisinumpaipagmalaakirepublicantondomisteryoprobinsiyamerchandisepinggankailangangbiglanglettagalmakakatakasmedya-agwasportspotaenakasalukuyanoktubrenakabaonnanlilisiknahawakanpinahalatahitsuramarketplacesnagkakasyarevolucionadonanlakibalitanagmistulanginilalabasmagkapatidtinangkatatawaganpamilyanaapektuhantubigsinaliksiktanggalinnangangalitnahintakutanculturekilalang-kilalasementopayatmendiolakumarimotknowledgelalabhanumiyakkinalalagyantumawanaiilangkinalilibinganmagkasamaunitedknowssingerpahirapanyeloalfredpantalonafternoontherapeuticsginawangpakinabanganmahuhulinalugodyangtuluyannaglulusakpagsusulitbinabaratmadadalatalinopisaratelevisedincitamenterprovidedinspiredtiyateamdaigdigdollarheisalbahengwealthkalupifracoatbundokaraytomaragostocredittatlokanayanghihigitwakasmaghapongtagaksikoscientistreplacedplasapesospagkabuhaynanalomakisuyoayonnauntogkahilinganabrilanywheresusulitkinantanetflixherramientacompositoressumisilipvisualtabasetting