Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Hindi ko alam kung bakit ang ibang tao ay madalas na mangiyak-ngiyak sa kahit anong bagay.

2. I'm so sorry. di makaling sabi niya habang nakatitig dun.

3. Nagtatrabaho ako sa Youth Center.

4. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

5. Gaano ko kadalas dapat inumin ang gamot?

6. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

7. Ang mga mag-aaral ay nag-aapuhap ng karagdagang oras para mag-ensayo para sa kanilang mga pagsusulit.

8. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

9. Sa lahat ng mga tao sa paligid ko, ikaw lang ang nais kong sabihin na may gusto ako sa iyo.

10. The invention of the telephone led to the creation of the first radio dramas and comedies

11. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

12. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

13. Sa harap ng tore, natatanaw ko ang ganda ng arkitektura at kahalagahan ng kasaysayan.

14. Ang taong hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

15. Dahan dahan kong inangat yung phone

16. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

17. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

18. Dumilat siya saka tumingin saken.

19. Walang kagatol gatol na sinagot ni Juan ang tanong ng kanyang teacher.

20. The culprit responsible for the car accident was found to be driving under the influence.

21. Si Juan ay nangahas na magtapat ng pag-ibig kay Maria sa kabila ng kanyang takot na ma-reject.

22.

23. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

24. Talagang dito ho sa palengke'y maraming naglipanang batang gaya niyan

25. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

26. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

27. Sila ay nagtutulungan upang magtayo ng mga organisasyon at kapatiran upang mapagtibay ang kalagayan ng bayan.

28. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

29. Matayog ang lipad ng saranggola ni Pepe.

30. Biglang lumiwanag ang paligid at si Ipong ay naging hipon.

31. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

32. Ang sabon na may pabangong rosas ay nag-iwan ng mabangong amoy sa aking balat.

33. Ang daming pulubi sa maynila.

34. The exam is going well, and so far so good.

35. Ang mga lumang talaarawan at dokumento ay dapat na itinuring bilang mahalagang bahagi ng kasaysayan.

36. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

37. Isang babae na mahaba ang buhok na kulot, nakablue gown sya.

38. The store offers a variety of products to suit different needs and preferences.

39. Le travail est une partie importante de la vie adulte.

40. Lumitaw umano ang isang nawawalang antigong larawan sa isang auction sa ibang bansa.

41. No dejes para mañana lo que puedas hacer hoy.

42. I woke up early to call my mom and wish her a happy birthday.

43. "Ang kabataan ang pag-asa ng bayan," ani ni Jose Rizal.

44. Sa ganang iyo, tama ba ang desisyong ginawa ng ating gobyerno?

45. Athena magpagaling ka.. sabi naman ni Abi.

46. Maraming uri ng mga punong-kahoy na maaaring gamitin sa paggawa ng mga gamit tulad ng upuan, mesa, at iba pa.

47. Inialay ni Hidilyn Diaz ang kanyang tagumpay sa Diyos at sa kanyang pamilya.

48. Isang makisig na binata na halos kaedad din ng magandang prinsesa.

49. Nakapila ako sa bayad center upang magbayad ng kuryente.

50. Ako ay nanatili sa iyong pagkatao subalit nagpadala ka mga pagsubok.

Similar Words

High-definitionhighest

Recent Searches

broadipinahighalinorderbitiwanampliakasamaangauditmagbayadre-reviewdispositivoefficienterrors,androidtableandytechnologicalconditionlargeawareibinubulongpagkapitasclientetiposformakumbentoparehongprodujomagta-taxitilgangmatipunodadalawautomatiskusuarioespadacramepagiisiptaingamartespinalutogatastagakwifiheartbreakpublicationagwadorincidenceadditionallysumingitaplicacionesnagpapaigibmagulayawthanklipadmagisingdumapaedsabumabaginisa-isaeclipxebuenatumaposmorningdoble-karanagbabalapaanonghandaanjackziconinantaypapasangpuntaemailcondovirksomheder,dadalhindollarunomabutingdinicuidado,ellacoursesinformedaga-agamwuaaahhkumampilivecontrolataon-taoneveningmonsignorstatusinspirationtumaliwasipagtatapatmagkaharapdoublenanghihinamadlandoniyanuniversitiespeer-to-peerskyldesbinibigayaseanpagdatingnagtransitgrabecountrieskantochadatemanirahansicasedentarykalalarovariousnagsasagotbinulabogpinanoodpag-aanisensibleulocomputerformsayusinsaadkinatitirikanprogramakasakitpinamalagipinoydividedpaggawaumibigisubosahodmaghatinggabihuertoagostopayongvegasiniangatgawalumbaydyosanakakapuntajejumagsasalitagumawacommissionpatungomabigyanmagnakawhumalakhakkinikitanangampanyakonsentrasyonpare-parehopagpapakilalanagliliwanagmagtatagaleskuwelahankasayawnakakitapotaenaformenergy-coalpinakamahabapamilyangnakapaligidnaguguluhangnagpabayadnakalipaspaglalaitsatisfactionnalalabinagsisigawkapangyarihangtuluyanpanghabambuhayfilmkasangkapanpaghalakhaknagtutulaknanghihinanaglipanangbaranggaymagkakailabarnag-iinomespecializadasnagkakakainkumakalansingngingisi-ngisingsalamangkeronakapapasong