Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Makakarinig ka ng halinghing sa gym, lalo na kapag may nagta-training ng cardio.

2. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

3. Ang poot ang nagbibigay sa akin ng lakas at determinasyon upang harapin ang mga hamon ng buhay.

4. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

5. Pumupunta siya sa Maynila bawat buwan.

6. Sopas ang ipinabalik ko sa waiter.

7. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

8. Hindi niya inaasahan ang biglaang promotion na ibinigay sa kanya ng kanyang boss.

9. Hindi mo matitiis ang mga maarteng tao dahil sobrang pihikan sila.

10. Hindi nakakatuwa ang mga taong nagpaplastikan dahil hindi nila nilalabas ang totoong nararamdaman nila.

11. The feeling of baby fever can be both exciting and frustrating, as individuals may face challenges in fulfilling their desire for a child, such as infertility or other life circumstances.

12. All these years, I have been grateful for the journey and excited for what the future holds.

13. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

14. Tangan ang sinipang pigi, ang buong anyo ng nakaangat niyang mukha'y larawan ng matinding sakit.

15. Me encanta enviar tarjetas de amor en el Día de San Valentín a mis amigos y seres queridos.

16. Sa daan pa lamang, bago siya pumasok ng tarangkahan, ay natatanaw na niya ang kanyang anak na dalaga na nakapamintana sa kanilang barung-barong.

17. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

18. Pakibigay sa akin ang iyong opinyon tungkol sa balitang nabasa mo.

19. Ibinigay ng aking mga kaibigan ang kanilang suporta at pagsuporta sa aking mga pangarap.

20. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

21. Sumigaw siya ng "sandali lang!" ngunit patuloy itong naglakad palayo.

22. Jacky! napalingon ako ng marinig ko ang boses ni Aya.

23. Sinundan ito ngunit nawala nang sumuot sa nakausling ugat ng puno.

24. Fødslen kan være en tid med stor stress og angst, især hvis der er komplikationer.

25. Mathematics can be both challenging and rewarding to learn and apply.

26. La música es una parte importante de la educación musical y artística.

27. Ang yaman pala ni Chavit!

28. Ilalagay ko 'to sa mga action figure na collections ko.

29. Nagpasya ang salarin na sumuko sa pulisya matapos ang mahabang panlilinlang.

30. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

31. Madalas syang sumali sa poster making contest.

32. Iba ang landas na kaniyang tinahak.

33. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

34. Me gusta escribir cartas de amor a mi pareja en el Día de San Valentín.

35. Sana makatulong ang na-fund raise natin.

36. Naririnig ko ang halinghing ng mga kalahok sa obstacle course race.

37. The writer published a series of articles exploring the topic of climate change.

38. Pagkatapos ng ulan, naging maaliwalas ang kapaligiran.

39. What goes around, comes around.

40. Ang dentista ay maaaring magbigay ng payo tungkol sa tamang pagsisipilyo at pagsisinok ng ngipin.

41. Mula sa bintana ng mga barungbarong, nakikita niyang nagsusulputan ang ulo ng mga bata.

42. May tatlong telepono sa bahay namin.

43. L'intelligence artificielle peut être utilisée pour prédire les résultats des élections et des événements futurs.

44. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

45. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

46. Langfredag ​​mindes Jesus 'korsfæstelse og død på korset.

47. Sa kaibuturan ng kanyang pagkatao, mahal niya ang pamilya niya.

48. Nagbabaga ang mga damdamin ng magkasintahan habang nag-aaway sila.

49. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

50. Umiiyak siyang gumuglong sa basa at madulas na semento.

Similar Words

High-definitionhighest

Recent Searches

highkamicandidatelabananmetodedaigdigeducationalmanyginoongprogramming,inithumihingieffectfalltabakasinglibropilingmaratingdownactivitycirclenanghihinamadnatatanawhayaanghudyatmakawalakitang-kitakaymuntikangasmenbaopaskokelankahoykahaponnagsunuranadmiredpanunuksoteacherkumarimotresignationexportdiscouragednapanapatayomakakatulongitanongnagibangkasangkapanpumilicommunitynapakopinag-usapannagkwentoikinamataymakikitulogwakasfallacomenamaitinalibundokbusyangginangbetaincidenceisasamaleobusilakisa-isainisipbilaobungangnakapayonginorderinaapibroughtincluirgustobayawakgamotinatakepapelbandanghistorybakantehimutokataqueshimselfandroidhimayinnakatitiyaknagngangalanggawaingboracaysambitmagtataasnanangismaka-alispresidentematchingkananaffectmag-anakkongchunkanluraniniuwinakakadalawpaksaposporoawardrosariobutasnapakahangapinakamaartengmakalaglag-pantyhulueducationapoyvistnicoganidmissionbuntisvivadissenogensindeilannagtutulakgeologi,kagandahagbaranggaymakikiraandistansyapagpapakalatmaglalarokinauupuangpaglalabadaemocionanteimpormakapalagsabadongumiiyaknagtakamaliwanagnakatindigmaipagmamalakingligababasahinkusinerosunud-sunurannapanoodkumidlatdiyaryokontinentengpagkuwanmagsugalnakatuontaosdiinevolucionadomensahekagipitanskyldes,siniyasatkaratulangtsismosatinuturoproducebinuksancombatirlas,umikotnationalnakapagproposecanteenbanalibabawkargahantamarawkindergartenexigentekassingulangmagisipmagkabilangnagbibigayansumasaliwbihasasumasakayhinukaymalasutlamatangumpaydiliginnilalangbarongipinambilikawayannapakabilisilog