Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Gaano kabilis darating ang pakete ko?

2. La campaña de donación está llamando la atención de la comunidad.

3. She is playing with her pet dog.

4. Bite the bullet

5. Yep, basta lang ibibigay mo sakin ang araw mo ngayon.

6. Ang mga pook na mayabong na mga bulaklak ay karaniwang pinupuntahan ng mga turista.

7. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

8. Ah talaga? Oo nga nuh, nung niyakap kita namula ka.

9. Halos dalawang linggong nag quarantine ang pamilya ni Josie matapos mag positibo sa covid.

10. Hindi dapat magbase ng pagpili ng mga kaibigan sa kanilang kababawan, kundi sa kanilang pagkatao.

11. Ang mga kabayanihan ng mga sundalo at pulis ay kailangan ituring at kilalanin bilang mga halimbawa ng tapang at dedikasyon.

12. Min erfaring har lært mig, at tålmodighed er en dyd.

13. El error en la presentación está llamando la atención del público.

14. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

15. The hospital had a special isolation ward for patients with pneumonia.

16. Hinugot ko ang papel sa loob ng envelope.

17. Tinulungan ko siyang dalhin yung mga plato sa dining room.

18. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

19. Sa anong materyales gawa ang bag?

20. Akala ko nung una.

21. La realidad nos enseña lecciones importantes.

22. Pahiram ng iyong sasakyan, wala akong ibang masasakyan pauwi.

23. Sa panahon ngayon, maraming tao ang nag-aagawan ng agaw-buhay na pagkakataon sa trabaho.

24. Ang daming linta sa bundok na kanilang inakyat.

25. Las rosas rojas son un regalo clásico para el Día de los Enamorados.

26. Pagkatapos ng misa, nagbigay ang pari ng mga panalangin para sa mga kaluluwa sa purgatoryo.

27. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

28. Si quieres que la comida esté picante, agrega un poco de jalapeño.

29. Maarte siya sa kanyang hitsura kaya lagi siyang nakabihis ng maganda.

30. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

31. May nakita umano ang mga residente na kakaibang liwanag sa kalangitan.

32. He has been meditating for hours.

33. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

34. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

35. Magtanim na lang tayo ng puno para makatulong sa kalikasan.

36. Menjaga kesehatan fisik dan mental juga berperan penting dalam mencapai kebahagiaan yang berkelanjutan.

37. Ang ina ay si Aling Rosa at ang anak ay si Pinang.

38. Halika, i-recharge natin ang baterya mo.

39. Ariana Grande is also an advocate for mental health awareness, openly discussing her experiences with anxiety and PTSD.

40. Hindi niya tinapos ang kanyang proyekto sa tamang oras, samakatuwid, hindi siya nakasali sa kompetisyon.

41. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

42. Les personnes ayant des antécédents de dépendance ou de problèmes de santé mentale peuvent être plus susceptibles de développer une dépendance au jeu.

43. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

44. Ku, e, magkano naman ang laman? ang tanong nga babae

45. Sa kaibuturan ng kanyang damdamin, mahal niya ang kanyang mga kaibigan.

46. May bukas ang ganito.

47. At sa sobrang gulat di ko napansin.

48. Bawal magpaputok sa kalsada dahil ito ay nakakabahala sa kapayapaan ng mga tao.

49. Nous allons nous marier à l'église.

50. Dapat bigyan ng karampatang atensyon ang mga isyu ng sektor ng anak-pawis.

Similar Words

High-definitionhighest

Recent Searches

nag-iisahighcoalleveragedisfrutaralinalituntuninngangnagtitiispitakaexpressionspinabulaananganungpalagaypagka-diwatanangingitianayanchefpagkakapagsalitaatensyonglibagtumunogluneskarununganannanakuhanglalakengpag-iyakjejuangkinghumahabamagpagalingratepumayagmahalganidinsektomahiramsummerbukailawtag-arawwestturonpaninigascountriesalapaapdealnatulognaglalambingmbalotuvomeriendabinitiwanlilykakayanantaon-taonsocialyumuyukomariemagandatinatanongbikolsapatmaynilanagliliwanagstyresumuotcountryconclusion,maglabagotanitoailmentsnagrereklamopangalanjerryplasmanagtagisansinapityoutubeleytebulaipagtanggolperangmagta-trabahokaybiliskaraokenatalonglaryngitisnakakaalamitinuturingnalalabisakalingbaliwspendingreadinglumakadnagkwentoisasabadkeepdissepantheonmuntinlupapasalubongnagbakasyonkasalananrockdesarrollaronhundredathenanag-aaralmadridstruggledmaluwangmasipagninongkaragatan,nanaypagdiriwangpagbatireservationworkdaytsetagilirannagliliyabsandwichprogramstextosistemastrabahoiniuwisuseeeehhhhlendbuhawininaipasokpaderstoplighttumaholminu-minutolandoplatformsinutusansisentapersonkitangbinatilyonangangalogmagpa-paskoitomontrealgasmenlookedselebrasyonmagkaibang1960stingtaingamagselosareanatatawakumakalansinggumagalaw-galawmodernekanilapagsisisimanalominamadalinagsunurantinulak-tulaksesamethroatmagbayadbiliperladibisyonpangkatnagsisihantsinadiamondpaceamingindividualmejomaaaripinaoperahanmeetingrecentnanalomatuloglamesasakaynagpabotblazingnag-pilotoninanaismagpa-ospitalpangit