Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1.

2. Oy saan ka pupunta?! Bayad ka na!

3. Mahalaga na magkaroon tayo ng mga pangarap upang maabot natin ang ating mga layunin.

4. Ang talambuhay ni Manuel L. Quezon ay nagpapakita ng kanyang pagmamahal sa bayan at liderato sa panahon ng kolonyalismo.

5. La música es una forma de arte que se disfruta en todo el mundo.

6. Puwede bang pahiram ng asukal? Magluluto ako ng cake mamaya.

7. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

8. The model on the runway was a beautiful lady who effortlessly commanded attention.

9. Nakapagreklamo na ako sa pakete ko.

10. Ang poot ang nagpapahirap sa aking isipan at pumupukaw sa aking mga kilos.

11. Mas maganda tingnan ang mga bulaklak sa dapit-hapon dahil kakaiba ang ilaw ng araw.

12. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

13. Nasa loob ako ng gusali.

14. Las labradoras son muy leales y pueden ser grandes compañeros de vida.

15. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

16. Aling lapis ang pinakamahaba?

17. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

18. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

19. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

20. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

21. Anong kulay ang gusto ni Merlinda?

22. The actor received a hefty fee for their role in the blockbuster movie.

23. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

24. Si Ana ay humanga sa disenyo ng saranggola ng kanyang kuya.

25. Biglang nagulat ang bata nang lumitaw sa harp niya ang isang duwende.

26. A quien madruga, Dios le ayuda. - The early bird catches the worm.

27. Inakalang walang interesado sa kanyang alok, pero marami ang tumawag.

28. "A dog is the only thing on earth that loves you more than he loves himself."

29. Kapag nakuha na niya ang aking puso saka lamang siya magkakaroon ng kapangyarihan sa mga nilalang dito.

30. Nagtataka ako kung bakit kailangan ko pang maghintay ng matagal bago mo ako sagutin.

31. They have been cleaning up the beach for a day.

32. Amning er en vigtig del af den tidlige babypleje.

33. Natuwa ang mga bata habang pinapanood ang lumilipad na saranggola.

34. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

35. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

36. Sa paligid ng bundok, naglipana ang mga ibon na nagpapaganda sa tanawin.

37. Nasa labas ka ba? Teka puntahan kita dyan.

38. Scientific data has helped to shape policies related to public health and safety.

39. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

40. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

41. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

42. Ang mga palaisipan ay maaaring nagbibigay ng mga oportunidad para sa paglutas ng mga problema at pagtugon sa mga hamon sa buhay.

43. Ibibigay kita sa pulis.

44. Dahil ika-50 anibersaryo nila.

45. Naghihinagpis si Maria nang malaman niyang hindi na niya makakasama ang kanyang pinakamamahal na aso.

46. Nagsmile si Athena tapos nag bow sa kanila.

47. Ang sugal ay isang mapanlinlang na paraan ng pag-asang maaaring magdulot ng pagkabigo at pagkasira sa buhay.

48. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

49. Eine hohe Inflation kann zu einem Anstieg der Zinsen führen, um den Anstieg der Preise auszugleichen.

50. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

Similar Words

High-definitionhighest

Recent Searches

highsasamahankalakingtiningnannakapapasongnahuhumalingnahahalinhannagsipagtagonagre-reviewfigurasnagpapanggapnag-aasikasokapeteryamisteryosongmapagkalingamanggagalingkumaripasmamamanhikanipaghandangayomakapaibabawtemperaturamagpasalamatpandidiricassandramagpapabunotdiliwariwdisciplinexpectationstinderalabing-siyambumuhosnakikisalodisappointedhoneymoonersnapakabaitmaskaraforskel,combatirlas,pagtatanongbecamehinahaplosgenerationerpagkakahiwaalintuntuninnapapahintounderholderpintotabingdagatsunud-sunodcomplicatedsinunggabanninonglalimsinasabirailmaabutansinungalingcommunicatepunung-punoanimoypunongkahoypetpunong-punopinagsasabipinagalitaninnovationpasasalamatpapagalitanabapaumanhinkumampieverymasukolpambahaypanunuksongfriendspanghimagaspamimilhingmakabangonmaaksidentetabacoughingsteamshipsbetweenpagsasalitakabundukankumapitpaghuhugaspagmamanehoenterunconventionalpagkakataonpagkakamalimagigitingpaghalakhaknasasalinannapatingalamagdamaganskirtnapapatungonapakalusognag-aabangnapakabangonangingisaynakikihukaynakangitingnakakatandainhaletilgangsinampalnakagagamotmarketing:pandemyanagtinginannagtatakangnagpipikniknagpapaigibnagkantahannageenglishmababangismapangasawamaninirahanmangingisdamanghikayatmakakabalikmagpagalingmagbigayanmagkababatamagbabagsikmababangongkinakawitankinaiinisankinagabihanforståkalawangingdali-dalingbooksexplainarawintsik-behocorporationhila-agawaninasikasogenerationsinuminuugud-ugodultimatelythroughouttelevisiontelebisyonstrategiesscientificsarisaringrememberedpintuanproductionpracticadopinuntahanpinahalatapamanhikanpalaisipanpakukuluanfluiditydisplacementpagtatapospaghakbangpagbabayadpaga-alalapag-aralinpabalingatnatatawangnapalingoninitnakikitangnakasilongnakabangganagtrabahonagtawanannagtagisannagsisunodnagpakunotnagmakaawanaglulusaknagkasunognamanghanaghuhukaynaghandangnag-umpisanag-iyakannag-iisangelectionsnabalitaanellenmonetizingminamasdanmateryalesmatatalinomapaibabawdepending