Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nagpapakain ako ng aking aso sa hatinggabi bago kami pareho matulog.

2. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

3. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

4. Aba oo, yun lang pala, nakakunot-noong sagot ni Kablan.

5. Hinde ko alam kung bakit.

6. Ano ang nasa bag ni Cynthia?

7. Ang biograpo ay nagsusulat ng mga kwento ng buhay ng mga kilalang personalidad.

8. Hinawakan ni Jigs yung kanang kamay ni Athena.

9. Oh! What a coincidence, dito ka pala nagtatrabaho?

10. Gandahan mo ang ngiti mo mamaya.

11. Scientific evidence has revealed the harmful effects of smoking on health.

12. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

13. La armonía entre los instrumentos en la música de Beethoven es sublime.

14. The influence of a great teacher on their students is immeasurable.

15. Tumawag ang pamilya ng albularyo upang gumaling ang kanilang kamag-anak mula sa misteryosong sakit.

16. Nasa harap ng tindahan ng prutas

17. Ihamabing o kaya ihalintulad ang isang bagay sa ibang bagay

18. Controla las plagas y enfermedades

19. Parang nahulaan ng kanyang ina ang kanyang iniisip.

20. Ang puting pusa ang nasa sala.

21. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

22. Ang masasakit na salitang binitiwan nya ay lubos na nakasakit sa kanyang ina.

23. Ginising ko si Cross, Oy gising. Umaga na.

24. Claro que te apoyo en tu decisión, confío en ti.

25. Regular exercise and playtime are important for a dog's physical and mental well-being.

26. Taksi ang sasakyan ko papuntang airport.

27. May email address ka ba?

28. Nahuli ang salarin habang nagtatago sa isang abandonadong bahay.

29. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

30. Gracias por ser honesto/a y decirme la verdad.

31. Kailangan nating magfocus sa mga bagay na may kabuluhan at hindi sa kababawang mga bagay sa buhay.

32. Ano kaya ang pakiramdam ng nakasakay sa eroplano.

33. Mahirap malaman kung ano ang nasa isip ng isang taong mailap.

34. Nagustuhan kita nang sobra, kaya sana pwede ba kita makilala?

35. Puwede ba bumili ng tiket dito?

36. Hiram na kasuotan ang ginamit niya para sa theme party.

37. All these years, I have been reminded of the importance of love, kindness, and compassion.

38. Eto ba parusa mo sakin? Ang masaktan ng ganito?

39. Bilang panghabambuhay na parusa ay pinamalagi ng Adang manatili sa labas ng Kasoy ang abuhing Buto nito.

40. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

41. Nagsmile si Athena tapos nag bow sa kanila.

42. Sayang, tolong ambilkan aku air minum. (Darling, please get me a glass of water.)

43. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

44. Nagtatrabaho ako sa Manila Restaurant.

45. Boboto ako sa darating na halalan.

46. Einstein's work led to the development of technologies such as nuclear power and GPS.

47. Pwede ko ba makuha ang cellphone number mo?

48. Gusto mong mapansin sa trabaho? Kung gayon, ipakita mo ang iyong husay at sipag.

49. Mayroong maraming tradisyon sa kasalan, tulad ng pagsusuot ng puting damit at paglalakad sa altar.

50. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

Similar Words

High-definitionhighest

Recent Searches

highmenspisarahinilatagpiangvictoriapantalongnaantigbinitiwanmakalingfulfillmenticonspecialspendingsutiltrackadverselydogrosedatiofficenakapamintananakikini-kinitamagsasalitakwenta-kwentamakakawawamalezat-shirtnagandahannagtitiisposporoobra-maestranagpapakainzamboangalabing-siyamopgaver,magbabagsikmensajesnananaghilikinikilalangtumahimiknanlilisikcultivanakakatabapanalangintitagovernmentpresence,estudyantemakikikainhampaslupanagmistulangpagtataaspuntahanvidenskabmanirahannagdadasalmagsasakapasyentenangyariwatawatkinalakihansumusulatsharelumisannag-emailsuzettekadalasnakabluenalugodpicturesnanangisisusuotkampeonsagutinnapahintorenaiapalitanpauwidumilatmetodiskgawasakopnagwikangestadosctricasbirdsnilalangsinisianung3hrsshadesbutasdisciplinligaligumibigisamamabaitknightcompositorestengalalakesilyanochebalinganhastadalanghitaboholadobomgayourself,inihandakananbumigaypataywasteconventionaltsedinanasbotantenunomansanaskinselookedbinilhanhinigitnameducativasadverseniligawanbrindarmatchingiatfattractivebalancesisinalangdonenergy-coalspreadrangesmokinginiunatinterpretingplatformsstandhoweverrightincreasinglyfaultbubonggraberolledactivitywhichbeyondtoolattackevolvestagedollareasyreleasedanak-pawispayokayang-kayangikinatatakotinferiorespaumanhinnanunuksounattendedmedikaltungkodmaglarofranciscosandwichdialledwaiternatandaanflaviouncheckedgoshsakafameayonscienceklasrumprimerjaneawaincreasesdraft,interviewingrenombremakakatakasanibersaryobiocombustiblesnakabulagtangkumbinsihininirapannaibibigay