Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

2. Sariwa pa ang nangyaring pakikipagbabag niya kay Ogor, naiisip ni Impen habang tinatalunton niya ang mabatong daan patungo sa gripo.

3. Hindi nya masikmura ang harap-harapang panloloko ni mayor sa kanyang nasasakupan.

4. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang maglingkod sa kanilang komunidad at sa ibang tao.

5. He admired her for her intelligence and quick wit.

6. The mission was labeled as risky, but the team decided to proceed.

7. Malinis na bansa ang bansang Hapon.

8. Ang dedikasyon ni Carlos Yulo sa kanyang isport ay nagdala sa kanya ng tagumpay sa pandaigdigang entablado.

9. Fødslen kan være en tid med stor stress og angst, især hvis der er komplikationer.

10. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

11. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

12. Bawal magtapon ng basura sa dagat dahil ito ay nakakasira sa buhay ng mga isda at iba pang karagatan.

13. El que mucho abarca, poco aprieta. - Jack of all trades, master of none.

14. Nang mawalan ng preno ang sasakyan, aksidente niyang nabangga ang poste sa tabi ng kalsada.

15. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

16. All these years, I have been grateful for the opportunities that have come my way.

17. I have been working on this project for a week.

18. Muchas personas disfrutan tocando instrumentos musicales como hobby.

19. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

20. Nakarating na si Ana sa gubat at pumasok sa isang kweba at lumabas ng may dalang basket na puno ng ibat-ibang uri ng gulay.

21. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

22. Kung sino ang maagap, siya ang magandang kinabukasan.

23. Saan niya pinapagulong ang kamias?

24. La agricultura sostenible busca minimizar el impacto ambiental del cultivo de alimentos.

25. The French omelette is a classic version known for its smooth and silky texture.

26. Buksan ang puso at isipan.

27. Aku benar-benar sayang dengan hewan peliharaanku. (I really love my pets.)

28. Sayang, aku sedang sibuk sekarang. (Darling, I'm busy right now.)

29. Si Chavit ay may alagang tigre.

30. Sa aming eskwelahan, ang mga mag-aaral ay nagtatanim ng mga gulay sa school garden.

31. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

32. Pulau Bintan di Kepulauan Riau adalah tempat wisata yang menawarkan pantai yang indah dan resor mewah.

33. Ang kanyang malalim na pangarap ay animo'y imposibleng maabot ngunit patuloy pa rin siyang nagsusumikap.

34. Sa simbahan, napansin ng pari ang magalang na kilos ng mga bata sa misa.

35. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

36. Ako ay nagtatanim ng mga succulent plants sa aking munting terrarium.

37. A lot of money was donated to the charity, making a significant impact.

38. Ang kalayaan ay hindi dapat nakasira sa kapakanan ng ibang tao.

39. Magsasalita na sana ako ng sumingit si Maico.

40. El perro ladrando en la calle está llamando la atención de los vecinos.

41. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

42. Candi Borobudur di Yogyakarta adalah salah satu candi Buddha terbesar di dunia yang sangat terkenal.

43. Patawarin niyo po ako, nagpadala ako sa mga pagsubok.

44. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

45. Bakit wala ka bang bestfriend?

46. Sino-sino ang mga kaklase ni Carmen?

47. "Bawal magtapon ng basura rito," ani ng bantay sa parke.

48. I have never been to Asia.

49. Nakita niyang lumalakad palayo ang kaibigan, na tila may tinatago.

50. Ang abuso sa kapangyarihan ay nagdulot ng katiwalian sa pamahalaan.

Similar Words

High-definitionhighest

Recent Searches

tiningnanpagtatanimmagseloshighpatunayancomunesemocionalrenombrebiocombustiblessikrer,earnasthmabilibidumabotpunsomanilapyestabackwaitumibigsabimanilbihanpumikitbentangnakatayokinakitaanknowhierbasulomaunawaanmagdidiskonagigingfuelproducemakapalitinatapatlendinggalaanpulangpagdamimassachusettsextremistcallpinggannagpakitamaputlacoloursasayawinnag-aabangitongmagsaingnagsulputantuyokulunganibonhinanakitaddressallekonsultasyonnanlilisikmagkikitanakasahodarbejdsstyrkerepublicbrasomensajesnakikini-kinitapinabayaangirlhospitalprogramming,compositoressettingnagdaraanmananakawmakikitulogemphasizediosresourcesedit:rebolusyonbitawanlegacykumembut-kembotnapilingpilipinassamakatwiddecreasefuelalakenginternabroadcastsgabingisusuotkeeppalayanklasrumcreationhomenagmungkahinaghanapmuchiwananslaveeducationalpanindanggobernadorinlovematapobrengiligtaskatuwaantiyaknakatuoncultivatedbalangbuhokipinasyangfreelancerwishingkainanginamitsoonalintuntuninkongraisedmangangalakalgenemeaningmakapangyarihanfysik,mangangahoynakapasatiyanahihiyangrimasumiimikmusiciansnagkitapagbibironamumulaklakyaripiecespinaghatidannapatigilparinmaidtingmismobumibitiwsakennakatunghayfathersalespamahalaanviolencemagkaparehopaumanhinmansanasnagbungawidekumitanovellesseekhumihingipagkagisingkasakittalinonagtatanongvelstandtiladispositivosnagrereklamosaturdaysasamabanalnamrevolucionadoaltbilaoinabutankahongaudiencemalasutlapakilutopakinabangannahuhumalingconvertidasipinabalikpooreripinagdiriwangprocesopisarakasocongratslunesbinigayheartbeatakongenglishpaki-drawing