Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Busy sa paglalaba si Aling Maria.

2. Las hojas de palmera pueden ser muy grandes y pesadas.

3. Nagpunta ako sa theme park kasama ang mga kaibigan ko kaya masayang-masaya ako ngayon.

4. Para lang ihanda yung sarili ko.

5. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

6. Siya ang nagpatuloy sa pag-aagwador.

7. Cryptocurrency wallets are used to store and manage digital assets.

8. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

9. Ang rebolusyon ay bunga ng pagkamulat ng mga Pilipino kontra kastila.

10. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

11. Muchas personas pobres no tienen acceso a servicios básicos como la educación y la atención médica.

12. Users can follow other accounts to see their tweets in their timeline.

13. The app has also become a platform for discovering new music, with songs going viral through TikTok.

14. Malungkot ka ba na aalis na ako?

15. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

16. The king's reign may be remembered for significant events or accomplishments, such as building projects, military victories, or cultural achievements.

17. Time heals all wounds.

18. Ang mailap na kaharian ay kailangan paghirapan upang mapasakamay.

19. Nagtataka ako kung bakit ganito ang mga nangyayari sa mundo ngayon.

20. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

21. Sebagai tanda rasa terima kasih, orang tua bayi akan memberikan hadiah atau makanan khas kepada para tamu yang hadir.

22. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

23. Ang dating kawawang usa a naging isang napakagandang diwata subalit hindi na rin natago ang mga sugat nito.

24. Mayoritas penduduk Indonesia memeluk agama Islam, yang merupakan agama mayoritas di negara ini.

25. Hindi ko maiwasang magtaka kung bakit may mga taong nagpaplastikan pa rin kahit alam nilang hindi sila magkakasundo.

26. Di mana bumi dipijak, di situ langit dijunjung.

27. At leve i overensstemmelse med vores personlige overbevisninger og værdier kan styrke vores samvittighed.

28. Anong bago?

29. Wala ho akong dinukot na maski ano sa kanya.

30. Kumain sa canteen ang mga estudyante.

31. Si Hidilyn Diaz ay naging inspirasyon din sa iba’t ibang mga atleta sa buong mundo.

32. O sige na, sige na! Tumahan ka na lang!

33. Si Ben ay malilimutin pagdating sa mga petsa ng okasyon, kaya lagi siyang may kalendaryo.

34. Napakamot na lang ng ulo si Kenji.

35. Nakatanggap si Nicolas ng sulat galing sa ninanais niyang paaralan, siya ay nakapasa dito.

36. The presentation was absolutely flawless; you did a great job.

37. May konsyerto sa plasa mamayang gabi.

38. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

39. Pumunta ako sa Laguna noong Sabado.

40. I like how the website has a blog section where users can read about various topics.

41. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

42. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

43. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

44. A king is a male monarch who rules a kingdom or a sovereign state.

45. Hindi na niya kaya ang mabibigat na gawain dahil mababa ang kanyang lakas.

46. Ang malawak na kagubatan ay isang magandang halimbawa ng isang ekosistema na mayabong.

47. Ang simbahan ay hitik sa mga deboto tuwing Linggo.

48. Pariwisata religi menjadi daya tarik bagi wisatawan lokal dan mancanegara yang tertarik untuk mengunjungi tempat-tempat suci dan melihat praktik keagamaan yang unik di Indonesia.

49. She does not procrastinate her work.

50. Ang pag-asa ay nagbibigay ng mga solusyon sa mga suliranin sa buhay sa tulong ng pananalig sa Diyos.

Similar Words

High-definitionhighest

Recent Searches

highinatakepagongparoldavaomalakasrevolutionizednapakagandangginisinglagunadollarkakaibadulimoneygandahanimpactayonumisipkatipunanmaya-mayagagamitinbukakaliwanakasahodageslandsutilnamangmakalinglabing-siyamdalawampumalagokarapatangpalmamusicmalakibagamakakaibangpagpilinaglulusakfitmayamayasusikampeonritoiba-ibangexhaustedbyggetrevolutioneretaniyapangungusapcondotutoringpaghakbangitinuloshukayhojas,nakaangatpaghahanapdontdatuhvordanlitomaestramailapuboconnectingsementongincludeindenkumitaminahaninapinagsasabiibonmaghihintayfollowednilutokasamaoverimprovedsoonbangmag-uusapbosslibrarymagsimuladumarayomapangasawakayabanganlandetnagbalikkasapirintessnag-pilotoschedulenagdadasallunesnagbabasamalamanfremtidigelamesapinsanmasasabiprocesonapadpadlumagonabuonag-ugatbalitabringingmaghapongpinagpagkamalasutlamoviesundeniableartistapadalasclientesallowingmakitasasagotlumamangiatfbalancesbangafederalismbuntisecijasteerkitangmukhaedukasyonpusamatulisabinagpapaypaykamapermitentumatakbonagwalisakongseryosoblusangkontinentengliligawandogmakakabalikpagkahapopakitimplamakapangyarihangpalakafreelancerpalapitkauna-unahangpostcardsalatsusulitkalawangingkatagangbigayhawakdekorasyonabaladarna18thsanggoltanawindoneinilalabasgamotmatutongbakasyoneverythingsisentabinigyanharapinautomationmagandangnapasubsobnapawileadinggamesamericanananaginipdagat-dagatanbilangmagtatampomarialangyatienennaglinisequipoganangpinaulanankasiyahangbulaklakpostnananaghili