Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang pagsusuri ng wastong hudyat ay mahalaga sa interaksiyon ng tao at sa pag-unawa ng iba't ibang anyo ng komunikasyon.

2. Siya ay hindi marunong magtimpi kaya't laging nagmamalabis sa pagpapahayag ng kanyang saloobin.

3. To infinity and beyond! at binaba ko ulit yung telepono.

4. She wakes up early every morning to exercise because she believes the early bird gets the worm.

5. Sa mga matatandang gusali, naglipana ang mga alamat at mga kuwento ng nakaraan.

6. Happy Chinese new year!

7. Walang sinumang nakakaalam, sagot ng matanda.

8. Pinanood ng bata ang babae habang ito ay kumakain.

9. Ang suporta ng pamilya ni Carlos Yulo ang naging pundasyon ng kanyang tagumpay.

10. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

11. Kailangan nating magbago ng mga lumang gawi, datapapwat ay mahirap ito gawin dahil sa kawalan ng disiplina ng iba.

12. Protecting the environment involves balancing the needs of people and the planet.

13. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

14. Certains pays et juridictions ont des lois qui régulent le jeu pour protéger les joueurs et prévenir la criminalité.

15. Ang mga estudyante ay sumailalim sa isang pagpupulong upang magbahagi ng kanilang mga mungkahi sa paaralan.

16. Hinawakan niya iyon sa magkabilang tirante.

17. Sa mga dagok ni ogor, tila nasasalinan pa siya ng lakas.

18. La foto en Instagram está llamando la atención de muchos seguidores.

19. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

20. Naglipana ang mga turista sa baybayin ngayong tag-init.

21. Hindi ako maaring abutan ng hatinggabi, kapag hindi ako umalis ngayon ay hindi na ako makakabalik pa sa amin.

22. Håbet om at finde kærlighed og lykke kan motivere os til at søge nye relationer.

23. Sayang, kenapa kamu sedih? (Darling, why are you sad?)

24. How I wonder what you are.

25. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

26. Les sciences de la Terre étudient la composition et les processus de la Terre.

27. Si Lolo Pedro ay pinagpalaluan ng kanyang mga apo dahil sa kanyang mga kwento at payo.

28. Nanlaki yung mata ko tapos napatigil sa ginagawa ko.

29. All these years, I have been creating memories that will last a lifetime.

30. Kucing juga dikenal dengan kebiasaan mereka untuk mengasah kuku di tiang atau benda lainnya.

31. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

32. Masarap maligo sa swimming pool.

33. Hinikayat ang mga turista na lumibot sa mga nakakaakit na tanawin ng naturang isla.

34. Emphasis can also be used to create a sense of urgency or importance.

35. Les investissements peuvent générer des rendements significatifs, mais comportent également des risques.

36. Storm can control the weather, summoning lightning and creating powerful storms.

37. Time heals all wounds.

38. Bakit niya gustong magpahaba ng buhok?

39. Sa kabila ng paghihinagpis, nagsikap ang mga residente na bumangon matapos ang trahedya.

40. Mahal niya si Steve kahit na sumpungin ito.

41. Ang daming limatik sa bundok na kanilang inakyat.

42. Doa bisa dilakukan secara individu atau bersama-sama dengan orang lain.

43. The traffic on social media posts spiked after the news went viral.

44. Peace na tayo ha? nakangiting sabi niya saken.

45. Halos wala na itong makain dahil sa lockdown.

46. Siya ay nanalangin para sa kaluluwa ng kanyang yumaong kaibigan upang ito'y makalaya na mula sa purgatoryo.

47. Musk has been named one of the most influential people in the world by TIME magazine.

48. Ano ang malapit sa eskuwelahan?

49. Det danske økonomisystem er kendt for sin høje grad af velstand og velfærd

50. Napuyat ako kakapanood ng netflix.

Similar Words

High-definitionhighest

Recent Searches

highsinakopnakapagsabimataikinabubuhaymagpa-checkupituturonahuhumalingtransportnakunapapatungohila-agawannakarinighistorialeadersmauliniganmaliksitaun-taonkasintahankabundukannaulinigandumilatpakilagaypanunuksoninumanoperahanbopolsmaglabalumbayatensyonhumpayjagiyapuedeslookedindiakontinganungbusyangsyaroomipantalopmayomemorialnilinismatsingformswindowcafeteriadevelopedmagkasamapagkaangattreatsnagkasakitvotesmagasinlumisanmanlalakbaymagpa-ospitalgawainglever,siksikantinahakapoylimitdialledumabotagostodiyosnewspaperskriskamatangmatalikpapayatirangboxcrosschefabijanepoloanotherdraft,poonkamalayanpadalasnagsimulabinentahanna-suwayluluwasnagtungonagbanggaanmagkasamangkidkirannalalabingpresidenteseryosonghinahanapculturasintramurossalbahetusindvisinstitucionesbiyastactosinimulansumayalinawmejopagkalungkotekonomiyastructureayanbringreportplacetagpiangmakapaghilamosmusicianscivilizationhearcareseriouspinag-aralangagawinnagmamadalinakapaligidsikre,ringnakatulogpangyayarihumiwalayinsektongnatinagpaboritongmahiwagafitnessumakbayabundantenapasubsobskabtlumayokulunganpamagatmamahalinipinambilipootkumukuhadyosapapalapithagdanankilayminamasdanpamamahingabinatilyokatolikotagalogpamimilhingbilanginibinalitangnanlalamigkahalagasamakatwidlalajudicialshopeelaropahirambilangtawamaliniscasesdependingchangejokesumamapinagkiskish-hoyhumalakhakinvestpuntahantumikimpunokumbentonaabutanmakilalamagdaraospabulongtumalimbinitiwanpneumoniaarturomatikmanrestawranbrasomahuhulimagbalikartistsmulighedersetyembretorete