Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang pagbabago ng pananaw at pag-iisip ay maaaring magdulot ng pagbabago sa pangamba.

2. Sa mga liblib na lugar, ang mga punong-kahoy ay nagbibigay ng sapat na kahoy para sa mga pangangailangan sa konstruksiyon at pang-araw-araw na gawain.

3. Ok ka lang? tanong niya bigla.

4. Menciptakan keseimbangan antara pekerjaan, waktu luang, dan hubungan sosial membantu meningkatkan kebahagiaan.

5. Ikinasuklam ko ang ginawa ni Pedro.

6. El cultivo de tomates requiere un suelo bien drenado y rico en nutrientes.

7. Nosotros celebramos la Navidad con toda la familia reunida.

8. Pakibigay ng pagkakataon ang lahat na makapagsalita sa pulong.

9. Lumapit ang matandang babae at ipinahayag ang kanyang hinagpis dahil sa kawalang-katarungan.

10. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

11. Nung nagplay na, una kong nakita yung sarili ko. Natutulog.

12. Ang mabuting anak, nagpapalakas ng magulang.

13. Ang kamalayan sa epekto ng teknolohiya sa lipunan ay nagbubukas ng mga pinto sa masusing pagsusuri.

14. Kinuha nya yung wallet nya at inabot yung bayad.

15. Dumating ang mga atleta sa entablado nang limahan.

16. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

17. Ang lakas mo uminom wala ka naman ambag.

18. Marahil ay magpapasko na kaya't maraming tao ang nagpaplanong bumili ng mga regalo.

19. Sa ganang iyo, mahalaga pa ba ang kultura at tradisyon sa modernong panahon?

20. Sa kanyang pag-aaral ng sining, pinagmamasdan niya ang mga obra ng mga kilalang pintor.

21.

22. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

23. Galit na galit ang ina sa anak.

24. Iyong kulay itim na bag ang bag ko.

25. Mahalagang mabigyan ng sapat na konsiderasyon ang mga isyu ng sektor ng anak-pawis sa pagpapasya ng mga polisiya ng pamahalaan.

26. Ang pagsusuri ng wastong hudyat ay mahalaga sa interaksiyon ng tao at sa pag-unawa ng iba't ibang anyo ng komunikasyon.

27. Lagi na lamang itong nag fe-facebook.

28. Inflation bezieht sich auf die allgemeine Erhöhung der Preise für Waren und Dienstleistungen.

29. Nagkakaroon ng pagdiriwang sa Batangas tuwing ika-23 ng Hulyo sa pag-alala kay Apolinario Mabini.

30. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

31. May meeting daw ang lahat ng guro kaya't kami ay maagang pinauwi.

32. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

33. Ant-Man can shrink in size and communicate with ants using his helmet.

34. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

35. Ang hindi marunong tumingin sa pinanggalingan, hindi makakarating sa paroroonan.

36. Pumupunta kami sa sementeryo tuwing undas.

37. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

38. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

39. Dumating siya mula sa Bikol kahapon ng umaga.

40. Drømme kan være en kilde til glæde og lykke i vores liv.

41. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

42. Ang pagtitiyak ng seguridad sa mga border at mga pantalan ay mahalaga upang maiwasan ang pagpasok ng mga illegal na droga sa bansa.

43. The traffic on social media posts spiked after the news went viral.

44. At habang umiisod ang pila, nararamdaman niyang lalong umiinit ang sikat ng araw.

45. Ang bakuna ay lubos na nakakatulong kontra sakit.

46. Hinde ko siya pinansin at patuloy lang sa pag kain ko.

47. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

48. He is running in the park.

49. Dalam beberapa kasus, orang tua bayi dapat meminta bantuan dukun bayi untuk merawat anak mereka.

50. Lapat na lapat sa kanya ang kamisetang iyon noong bagong bili ngunit ngayo'y maluwag na.

Similar Words

High-definitionhighest

Recent Searches

highcandidatedollarmagingpracticadolabananrolledlockdownochandoincreasinglylastingibabaputienforcingvarioustargetipinagbilinghelpfultopic,alepressiosfaultfuncionarkasinggandananonoodmagpupuntanakitamapshifterrors,napilingulotopiccurrentcontrolagitarawithoutvankasingflashexplaindifferentcomunicarseelectsmallmultosambitreallyvieweffectspakilutokainipinamiliganidentoncesstarferrersinunodcontentimbespamamagitannailigtasmakabilimagtigilkontrataumiiyaknagliwanagmakasilongnapanoodmagkahawakikinalulungkotnakapagsabibaku-bakongpahingalpinigilanthanksgivingmagtakainilistamauupokumirotilalagaytumikimhumihingiarturonabuhaypabulongnag-iisiptulongandreacaraballoninyongalas-dosmahigitydelserpayongpilaalleinfusionesngipingkutsilyostandomfattendemagkaibamasayahinpoorercorporationnalangcynthiahumpaymarieshoppingaguat-shirtiniwantomorrownaalismalamangsumagotpatutunguhannegosyantetapospootglobalbipolartalagalorenahatingnegativedaangenekapagpartsganangumuusignakagawianmarahilinspireaniyapagluluksaipinahamaktigilresponsibleobstacleshalagaendhimselfngpuntatabastextobridepasangwatchminutepawiinpagpapakalathagikgikkamakabibisellpedenginantokmodernstapleahithearareasbinilhanscottishanayipatuloynanghihinamadfuturebituinpuntauniquemenuayancallingimpitformdingdingcrazydebatesbalitanapakatalinoikinasasabikmakakatakaskumembut-kembotnagsisipag-uwianpagbabayadnakatitigactualidadbrancher,taga-hiroshimahoneymoonuugod-ugodmagsusuotpagkabiglaleaders