Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Women have a higher life expectancy compared to men, on average.

2. Tumatakbo parin ang metro ng taxi kahit nakatigil ito dahil sa matinding traffic.

3. Ayoko pong nakakulong sa madilim na lugar na kinalalagyan ko.

4. Isinalang ni Pinang ang lugaw ngunit napabayaan dahil sa kalalaro.

5. Los agricultores a menudo trabajan en estrecha colaboración con otros miembros de la cadena alimentaria, como los transportistas y los minoristas.

6. Ayam goreng adalah ayam yang digoreng dengan bumbu khas Indonesia hingga renyah.

7. Lumingon ako para harapin si Kenji.

8. Nabigla siya nang biglang napadungaw sa kanya ang isang ibon.

9. Hindi ko maaaring payagan ang aking mga agam-agam na hadlangan ang aking mga pangarap.

10. Napakaganda ng loob ng kweba.

11. Utak biya ang tawag sa mahina ang pag iisip

12. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

13. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

14. Yumabong ang pagmamahal ng mga tao sa mga hayop dahil sa mga kampanya para sa kaligtasan ng mga endangered species.

15. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

16. Ang digmaan ay maaaring magdulot ng pagkasira ng mga kultura at tradisyon.

17. Nawala yung antok ko. May pumasok na evil plan sa utak ko.

18. They have been cleaning up the beach for a day.

19. Naglalaba si Maria ng mga damit tuwing Linggo para sa buong pamilya.

20. Makaka sahod na siya.

21. Ang talambuhay ni Apolinario Mabini ay nagpapakita ng kanyang talino at dedikasyon sa paglilingkod sa bayan.

22. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

23. Nag-aalalang sambit ng matanda.

24. Nagwalis ang kababaihan.

25. Naglalambing ang aking anak.

26. Eksporterer Danmark mere end det importerer?

27. Inalagaan niyang mabuti hanggang sa ito'y magbunga.

28. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

29. Ang arte. bulong ko sa may batok niya.

30. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

31. Bantulot niyang binawi ang balde, nakatingin pa rin kay Ogor.

32. Has he started his new job?

33. Some couples choose to have a destination wedding in a different country or location.

34. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

35. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

36. Ang sugal ay isang hindi maiprediktable na aktibidad na nagdudulot ng excitement at thrill sa mga manlalaro.

37. Makikita ko ang mga kapatid ko sa pasko.

38. Sila ang unang angkan ng mga aso sa daigdig.

39. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

40. Sa takip-silim, maaari kang mapakali at magpakalma matapos ang isang mahabang araw.

41. Habang naglalakad siya, nakita ko siyang tulala sa kanyang cellphone.

42. Mababa ang marka niya sa pagsusulit dahil hindi siya nakapag-aral.

43. Aba makulit ang matandang ito! Lumayas ka rito! Doon ka sumisid sa dagat.

44. She learns new recipes from her grandmother.

45. The company's profits took a hefty hit after the economic downturn.

46. Bawat umaga, ako'y bumabangong maaga para maglakad sa dalampasigan ng karagatan.

47. El atardecer en el mar es un momento sublime que muchos aprecian.

48. "Dogs are like potato chips, you can't have just one."

49. Keep studying and hang in there - you'll pass that test.

50. Su obra más famosa es la escultura del David en Florencia.

Similar Words

High-definitionhighest

Recent Searches

highpapelnapagtantomagsasamaandroidbetweenmagbagosynligetermpermitekadalagahangpag-unladtapemakapasabulalasproductividadkumantaprovideformatmatalimnaghuhumindigkalanpollutionsabihinnaguguluhannapiligumawadalilalargapagkakahawakpagkatmatutulogmatutuwapetsagumuhitcharitablenagpapaigibnagtrabahokasaganaanpaga-alalanakakasamamangangahoytobacconangampanyamarketplacesobra-maestramatustusaninvitationhalikanawalanakagalawkinikitapunong-kahoymagpa-picturenagkakatipun-tiponnapuputolbalitapinuntahannapasigawsasayawinbinibiyayaanhubad-baropinahalatapagdukwangna-suwaysalenakahigangdenulammaghahatidnapapahintonakakainmagtatanimpinigilankaklasemagkakaroonarbejdsstyrketumunogtennisnangapatdankanginamusicalesnag-emailnakalockipinatawagjingjingsasakaygawinpanindakampeontig-bebeintepaligsahanpicturesvidtstrakttumatawadeksempelgumigisingpaidnasaannagsipagtagostevesocialespakibigyanpagongpakistanadvancementpasasalamatdireksyonindustriyamagbabaladepartmentibabawlakadhatinggabidealpiyanodescargarhinagispesohanapinganunnamintsinelasnahulaannatatanawkatagangcoughingbunutannaiwangpnilitfremstilletelevisiondreamsnatinagnalagutanutakaffectaccedertumalikodanamatapangproudlarongsiglabiyaspatiencebaryothroattomorrowgymmakaiponatensyonnakabilimasarapkumikilosmakapangyarihangmartesdemocracybigotesaycomputere,kelanipinasyangplasalenguajekumatoknagbanggaancupidkadaratingbinibiniasulmassesnoorailwayspinatidsumayapagodjerrycafeteriapagefeelkamatissorejacebook:heareffortsvillageconcernsoutpostlegislativechessdedication,suelocoaching:thenfacebooktitaniyogmore