Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

2. Sa araw ng pamamamanhikan, dala-dala ng pamilya ng lalaki ang mga handog para sa pamilya ng babae.

3. Hindi dapat magpabaya sa pag-aaral upang makamit ang mga pangarap.

4. Sa mga siyudad, mahalaga rin ang mga punong-kahoy dahil nakakatulong ito sa pagpapalinis ng hangin.

5. If you think I'm the one who stole your phone, you're barking up the wrong tree.

6. Sa pagpapakumbaba, maraming kaalaman ang natututunan.

7. La boda de mi amigo fue una celebración inolvidable.

8. The basketball court is divided into two halves, with each team playing offense and defense alternately.

9. Sa pamamagitan ng kalayaan, malaya tayong magpahayag ng ating mga opinyon at paniniwala.

10. Les préparatifs du mariage sont en cours.

11. Yey! Thank you Jacky! The best ka talaga!

12. Mahusay gumawa ng bahay ang kanyang tatay.

13. Kapag mahangin, inililipad nito ang mga dahon palayo sa halamanan.

14. Tumututol ako sa kanilang plano dahil alam kong may mas magandang paraan para matupad ang layunin nito.

15. Magandang-maganda ang pelikula.

16. Sa simoy ng hangin, maaamoy ang mabangong amoy ng damo sa bukid.

17. Happy Chinese new year!

18. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

19. May tatlong bituin ang watawat ng Pilipinas.

20. Nagluluto si Tess ng spaghetti.

21. Sinunod ni Mang Kandoy ang bilin ni Rodona.

22. ¿Cuántos años tienes?

23. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

24. Laging kinatatakutan si Kablan sa pagiging usurero sa Palawan, ang pating naman ay lagi ring kinasisindakan sa kabangisan.

25. Nagpagupit ako sa Eclipxe Salon.

26. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

27. Natutunan ng mga mag-aaral ang talambuhay ni Melchora Aquino bilang isang "Ina ng Himagsikan."

28. Puwede bang pahiram ng asukal? Magluluto ako ng cake mamaya.

29. Ang pamilya ang siyang nagbibigay ng kalinga sa bawat isa.

30. Las redes sociales son una parte importante de nuestras vidas hoy en día.

31. Scissors can have straight blades or curved blades, depending on the intended use.

32. She has been making jewelry for years.

33. Sa kultura ng mga Igorot, mahalaga ang punong-kahoy dahil ito ang ginagamit sa kanilang mga ritwal.

34. Sepandai-pandainya tupai melompat, akhirnya jatuh juga.

35. Maraming mga tao ang nakatambay pa rin sa mga tindahan sa hatinggabi.

36. Ang mga paputok at pailaw ay karaniwang bahagi ng pagdiriwang ng Chinese New Year.

37. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

38. Ang bayanihan ay nagpapakita ng diwa ng pagmamalasakit at pagbibigayan sa aming komunidad.

39. Les enseignants sont responsables de la gestion de classe pour garantir un environnement propice à l'apprentissage.

40. Lungkut na lungkot ang buto sapagkat madilim na madilim sa loob ng kasoy.

41. Det er også vigtigt at sætte et budget og begrænse sin risiko for at undgå at miste mere end man har råd til.

42. The patient's family history of leukemia increased their risk of developing the disease.

43. El concierto de la orquesta sinfónica fue una experiencia sublime para los asistentes.

44. Ang pagkakaisa ng buong nayon sa panahon ng krisis ay lubos na ikinagagalak ng kanilang lider.

45. Las heridas pueden ser causadas por cortes, abrasiones o quemaduras.

46. She has excellent credit and is eligible for a low-interest loan.

47. Hockey coaches develop game plans and strategies to help their team succeed.

48. Ang tagtuyot ay nagdulot ng krisis sa agrikultura sa buong rehiyon.

49. Dalawampu't walong taong gulang si Paula.

50. Patuloy pa rin ang paghalik ng butiki sa lupa tuwing dapit-hapon.

Similar Words

High-definitionhighest

Recent Searches

highgranadaaggressionregularmenteevilumuwihelloalignsallowedrobertnagingitemsorasanpolosalbahelibagginawakargangutaknatintodasangkanna-suwaynapaplastikanwakasmapaibabawnakikilalangmakebakagabrielestablishyumabongkagandahannapakagagandanegosyantekaaya-ayangmagasawangngunittennisnecesariopalaisipankwartokumpletonagdadasalmangahasbwahahahahahabasurahila-agawangawindistanciakamandaghigantevidenskabnatuwamusicaltumingalapalasyoctricasaspirationsisentamagkakapatidarkilaprosesodisciplindiseasehintuturosiponlegacypatayadditionally,tinulunganklasrumalaalabestsumunodtinderatapatisinalangmarsoperlarailteknologiimaginationpasanamazonpetertrackthereforehiniritrelogitanasbroadcastspublishedpuedekawili-wiliagosyayapinangaralanmagtiwalasasamahannakusmilenapapadaanculturalguestsgovernorsdingginmangkaawa-awangsermakipag-barkadatextokasiyahangenerositywhilemayabongnaiilangcurrentnakasandigsilangpambansanglaganaptatlumpungsalenagpalalimfilmdistansyamakalaglag-pantyosakalumalangoymakapaibabawnagkitamakikitaresearchnewpasadyanakatuwaangkasangkapanbangladeshdeliciosanalagutanmanghikayatmananakawkatuwaankumikiloskalalarokongresomarurumipangangatawanmakikitulognangapatdanmasaktanpagbigyannapatigilroofstockmaligayamismowriting,junepagkaingcareerlinanatitiraskypebigoteaudiencekasingtigaslenguajedennemaisipproductscubiclemabilisbutihingpagodresignationkitang-kitagalitpagbahingbernardolegendslangsincecebupasanglcdeksamredochandoapollorelievedbowbringgumigisingmultoreallygenerationshapasinprogrammingtutorials