Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Tulala siyang tumitig sa malawak na tanawin ng dagat.

2. Paano mo pinaghandaan ang eksamen mo?

3. Me encanta pasar tiempo con mis amigos jugando al fútbol.

4. Chumochos ka! Iba na pag inlove nageenglish na!

5. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng stress dahil sa kanyang rational thinking.

6. The foundation's charitable efforts have improved the lives of many underprivileged children.

7. Hindi umabot sa deadline ang kanyang report, samakatuwid, binawasan ang kanyang grado.

8. Hindi dapat pagbasehan ang pagkatao ng isang tao sa kababawang mga bagay tulad ng panlabas na anyo.

9. Kinagabihan, wala si Pinang sa bahay.

10. Napapaisip ako kung ano pa ang mga magagandang paraan upang mapaligaya ang aking nililigawan.

11. Magandang maganda ang Pilipinas.

12. Nagpunta ako sa may lobby para magisip.

13. Mas magaling siya kaysa sa kanya.

14. Sa panahon ngayon, maraming taong nagfofocus sa kababawan ng kanilang buhay kaysa sa kabuluhan.

15. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

16. Ang pagkapanalo ng koponan ay siyang ikinagagalak ng lahat ng sumuporta sa kanila.

17. Pumuslit ang luha sa sulok ng kanyang mga mata.

18. Bagamat sa Limasawa, Leyte nagdaos ng unang misa, may isang paring Kastilang nagngangalang Padre Novelles ang nakarating sa lalawigan ng Nueva Ecija.

19. Pang-isahang kuwarto ang gusto niya.

20. Puwede ko ba mahiram ang telepono mo?

21. The momentum of the rocket propelled it into space.

22. Min erfaring har lært mig, at tålmodighed er en dyd.

23. Isang babae na mahaba ang buhok na kulot, nakablue gown sya.

24. Ang malalakas na hiyaw ng galit at pagkadismaya ay binulabog ang kapayapaan ng pagtitipon.

25. Nació en Caprese, Italia, en 1475.

26. Ang pagbabalik ng kanyang pinakamatalik na kaibigan mula sa ibang bansa ay labis niyang ikinagagalak.

27. Magsi-skiing ako sa buwan ng Enero.

28. Anong oras mo ako ihahatid sa airport?

29. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

30. The telephone has undergone many changes and improvements since its invention

31. Sa pagguhit, puwede ka rin mag-experiment ng iba't-ibang kulay at matutunan ang mga color combinations.

32. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

33. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

34. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

35. Umabot sa hukuman ang panaghoy ng mga biktima ng kalamidad para humingi ng hustisya.

36. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

37. Maging ang mga mahihirap na disenyo ay kaya ng gawin ng bata sa murang edad.

38. Napakaraming bunga ng punong ito.

39. Effective use of emphasis can enhance the power and impact of communication.

40. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

41. Si Pedro ang tatay ko at siya ang nanay ko.

42. Ang aking kabiyak ay ang aking tahanan, kung saan ako nararamdamanang tunay na pagmamahal at suporta.

43. Quería agradecerte por tu apoyo incondicional.

44. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

45. She is not designing a new website this week.

46. Si Josefa ay maraming alagang pusa.

47. Naging mas makapal nga ang buhok ni Rabona.

48. Tumayo yung limang babae at lumapit kay Kerb.

49. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

50. Ang taong mapagbigay, sa kapwa ay may kapatid.

Similar Words

High-definitionhighest

Recent Searches

broadmangungudngodplanhighmaariumabotrequirerepresentativeaffectevolvedbilingremotemediumworkberkeleypublishedryansmallnakaraangbighanidisensyotirahanhinamakpakiramdammaramiencountertila1787nanlalambotcompletamentesasakaynenaknowsgripodonationsipaghugasmusicaltuvoilingfuturesyamasayaconclusionyeahregularmentepaghahanappag-indaklakadagawaffiliategisingkainnationalhealthtuluyanpinapaloabuhingnapagtantotelephonenatinmatalinosasapakinkitangninyorolandmind:lumayoinaabutandomingokantobaduynararamdamannagpasankapitbahaynalalagassanasnagbuwistiyakhiwamemorykinakaligligikawnangangahoyannamabihisanpinamumunuanlistahanexperts,tumingalainfluentialindividualnandiyancadenalimoslilikopinunitnakabalikuusapandaigdiganilimangkarangalansuccessfullibanganedsafederalsinuotsmokerlalawigannakatapospinasokmadurasanumallsdawnamaculturesoverallnaghilamosmaghaponpusingbuhaytapebakasyonmaglutogabibetakumampinababalothinimas-himasexpandeddalawangunitadobonahigitankawalannamulamasamasakupinnagkakatipun-tiponlinggokasamahanbabasahinroomblesskapainrabemasinopshadeskatolikofrielumakasbinyaganghumihingiwaringpinahalatanagkakasyaleaderselitemasaksihankinalakihanpinakawalannagsisilbilapatevenestasyonhumalakhakmaaaridesarrollaraplicacionesnamumulotmalasutlakararatingpagmasdani-collectreboundmarurusingnakangisigulaybeenlifepinagsikapan300ninyongclasesantibioticsmakasamamakapagbigaytekaisinisigawpagtangopandidirinalangpedrolangyaechaveewannakasakitmaawajuan