Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. In Spanish cuisine, a tortilla española is a thick omelette made with potatoes and onions.

2. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero may gusto ako sa iyo.

3. Les algorithmes d'intelligence artificielle peuvent apprendre à partir de données et améliorer leur performance au fil du temps.

4. Gusto mo bang maglaro ng basketbol?

5. Para cosechar las almendras, primero se deben sacudir los árboles con cuidado.

6. Masayang-masaya siguro ang lola mo, ano?

7. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

8. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

9. Sa kanyang pagda-drive, nabigla siya nang biglang tumawid ng daan ang isang pusa.

10. Huwag kang maniwala dyan.

11. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

12. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

13. Libreng nakakakuha ng atensyong medikal ang lugar nila Alfred.

14. Saan siya nagtapos ng kolehiyo?

15. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

16. Sino ang kinukuha ng mga sundalo?

17. Naging kaulayaw ko siya noong ako'y nag-aaral pa lamang.

18. They go to the movie theater on weekends.

19. They travel to different countries for vacation.

20. Si Ma'am Luisa ay magbabakasyon sa kanilang probinsya.

21. Sa tuwing nadadapa ako, hindi ko mapigilang maglabas ng malalim na himutok.

22. She does not use her phone while driving.

23. Sa kabila ng hirap, ang kanyang loob ay hindi kailanman naging mababa.

24. Ang tag-ulan ay isa sa mga panahon ng taon na nagdadala ng malakas na pag-ulan at kadalasang nagdudulot ng baha at landslides.

25. La paciencia es una virtud.

26. Sa mga kasal, kadalasan ay mayroong pagbibigay ng regalo sa mga panauhin bilang pasasalamat sa pagdalo.

27. Emphasis is an important component of artistic expression, such as in poetry and music.

28. Since curious ako, binuksan ko.

29. Napakahalaga ng pag-unlad ng mga pagsasaliksik sa talambuhay ni Apolinario dela Cruz bilang isang relihiyosong lider.

30. Ang dentista ay propesyonal na nag-aalaga sa kalusugan ng ngipin at bibig.

31. Ang biglang pagkakaroon ng mga protesta ay binulabog ang kapayapaan ng lungsod.

32. The United States has a system of separation of powers

33. She is not playing with her pet dog at the moment.

34. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

35. Ang pangamba ay hindi dapat iwasan, sa halip ay dapat itong harapin upang maiwasan ang mas malaking panganib.

36. Wie geht es Ihnen? - How are you?

37. She enjoys cooking a variety of dishes from different cultures.

38. Sa tuwing nakikita ko ang aking kabiyak, nadarama ko ang kumpletong kaligayahan sa aking puso.

39. Ngunit hindi niya alam na nakasunod ang mga kababayang niyang walang ibang inisip kundi makakuha ng pagkain.

40. Habang maliit pa ang bata ay itinuro na ng mag-asawa kung paano ang humabi.

41. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

42. Hinanap nila ang magandang babae upang pasalamatan ngunit wala na ito.

43. El teatro experimental presenta una interpretación sublime del teatro moderno.

44. Di rin ako paulit-ulit ha! Di yan ang lagi kong sagot!

45. Jodie at Robin ang pangalan nila.

46. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

47. Natapos ko ang aking trabaho sa opisina sa hatinggabi dahil marami akong backlog.

48. Let's not make this into a big deal - it's just a storm in a teacup.

49. Ang mga guro ay humingi ng mga mungkahi mula sa kanilang mga mag-aaral upang mapabuti ang kanilang pagtuturo.

50. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

Similar Words

High-definitionhighest

Recent Searches

highibabaredarealockdownpersonsprogresscontrolainteractcertainsalapitwogottechnologieshapasinryaneditorincreasesvanipagpalituwakdahontumakasnag-emailtumunoghiningingpuntaginagawaiintayintechnologicalkailanmansamantalangnamilipitnaglakadmaglutoxixalamidpamilihanitinanimnakabibingingorasampliadurantewealthpagkapanalolarangansasakyandollarekonomiyamagsuotmulti-billionnapadaanmaalognakakapamasyaltumawalever,maisippinag-aralanaliskaibanapakahabaalapaapnaabotnapadpadgumapangsupremesarongtanongsundaeiconsbingofrescokinukuhapakibigyandeterioratesukatbestidolabananbalingsimplenggapsampaguitamahigittodaytatayokumikilossunud-sunurannasiyahaninvestmagtatagalpakanta-kantangnakakasamanagsisigawobra-maestralumuhodkinagagalakkumukuhagratificante,nagbanggaannagliliwanagnagpapaniwalamagsasalitanapaiyakpinagkiskisbinibiyayaannapakamotmagagandangnalalabivillagemagtigilpahiraminakalamaibibigaymakakabalikinaabotpaulit-ulitpananglawpanindanakahainumigtadsinimulansuotfauxanywhereumaagoshvermurangpinagkaloobannapilicover,siyudadlolapakistantalaganghalinglinggatoltusongmatchingnatuwataglagaseconomicarturomartianpayongmukhainstitucionesplanning,lupainnaiwangmaalwangandoytawanantusindvissalbaheangelaestilosiyakfe-facebookpinatidjuiceinulitincidencenaiinitantuvoanakulangkirotpagkapunonakasuot1920storeteipapaputolamerikapagodemailcommissiongandasoreconcernsbarriersbetamensahesikatumanokomunidadmabilislupaproyektougalibudoknangampanyafindpaskoawasilbingsinipangisugabumahabarposter