Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

2. La paciencia es una cualidad que se debe cultivar.

3. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

4. Me siento mejor cuando me rindo al destino y acepto que "que sera, sera."

5. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakatotoo at magpakabuti.

6. Les personnes endettées peuvent se retrouver dans une situation financière difficile.

7. Congress, is responsible for making laws

8. Kuripot daw ang mga intsik.

9. Ibinigay ko na ang lahat ng makakaya ko upang matulungan ka.

10. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

11. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

12. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

13. Maraming Salamat!

14. Sa isang iglap ay nakalabas sa madilim na kulungan ang Buto.

15. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

16. Humingi ng paumanhin ang inang makakalimutin subalit nagsiklab sa galit ang anak na sutil.

17. Masaya at masaganang na naninirahan ang mga tao dito nagtutulungan at nagbibigayan din sila, kung tutusin perpekto ang bayang ito.

18. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

19. Pigilan nyo ako. Sasapakin ko talaga 'tong isang 'to.

20. Ano-ano ang mga projects nila?

21. Dahil sa matinding ulan, nasira ang aming picnic at ikinakalungkot namin ito.

22. The pretty lady walking down the street caught my attention.

23. Skynd dig ikke for meget. Du kan falde og slå dig. (Don't hurry too much. You might fall and hurt yourself.)

24. Nakuhang muli ang gong at nagkaroon pa ng punong may matamis na bungang hugis kampana ang mga taong-bayan.

25. Totoo nga! Sa ilalim niyon nakabaon ang gong na susi ng kanilang kasaganaan.

26. Napakalaking ahas ang nakita ni Anjo.

27. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

28. Awitan mo ang bata para makatulog siya.

29. Mula pagkabata ay naging magkaibigan na si Lando at Maria.

30. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

31. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

32. Ang agila ang pambansang ibon ng Pilipinas.

33. Nood tayong movie. maya-maya eh sabi niya.

34. Sigurado na siyang walang panalo sa kanya ang matanda.

35. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

36. Ang mahal pala ng iPhone, sobra!

37. Sa pagguhit, mahalaga ang tamang pagkakabalangkas ng mga elemento.

38. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

39. Kailan at saan po kayo ipinanganak?

40. Ang hirap maging bobo.

41. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

42. "Hindi lahat ng kumikinang ay ginto," ani ng matandang pantas.

43. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

44. Tila asong nagpipilit makapaibabaw si Ogor.

45.

46. Mag-iikasiyam na nang dumating siya sa pamilihan.

47. The ad might say "free," but there's no such thing as a free lunch in the business world.

48. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

49. Omelettes are quick and easy to prepare, making them a convenient meal option.

50. Nilalakad namin ang mapa para mahanap ang aming pupuntahan.

Similar Words

High-definitionhighest

Recent Searches

highangmagingmayojamesmawalastatingextra2001communicatecornersjuanitobagyongsantonagkatinginangoodcallingdalangnageenglishmalayopagkamanghaikinalulungkotikinakatwiranhulupagkasabigulatfranciscotumatakbopasukanmagkasabaymaibabalikhuniproducererenergiwaiternenamaulittoymanuksodoonlorisurgerylutuinhaloselectedsighpatience,expeditedabalangnanghahapdinanlilimahidforståiwinasiwassang-ayonwesleyipaalamgovernmentmakikiligonag-poutmagkakailapakikipaglabanpamilyahurtigeremilyongnakapagproposekatolisismosakimgigisingyoutubedreamsalamukaabenebosspakelamrefersspeednagreplyerrors,sameenforcingpautangbinuksannaglahongsamakatuwidnakatunghaykonsultasyonfysik,poongextremistcomunicarsetotoongeksport,paosnakabiladmakakatataasmarilouseekbluemacadamiaeksenapapuntamakitaumakyataccederngingisi-ngisingsimbahankabundukanpamburachangedpinamalaginabighanibabasahinberegningermagtakakassingulangnabuhayumikotmaranasankindergartennatakotmalawakbibigyannatigilanconectadosarguewordsumakaypublishingexitmasiyadopasya18ththoughnag-iinomclassmatebreakschooldakilangtatawagworkestudyantenapakalusogbibisitakabutihannaglulutomaliwanagtaosinilabasnagbabalaalakelenakaratulangganunpromisegawingmatutongbuntishinognaishangindinalawsumabogadangkamatisscientistreducedbumababatools,powerstransittipidnakasandigcigarettesunasettinglearningmaratinglibrohumaliksariwabudokkontratanakakatawanapaplastikannakatuwaangnakagalawnagulatmagpakasalkahariansalemalungkotpakikipagbabagseguridadsunud-sunuranharapansementongmadungisbihasa