Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nanginginig ito sa sobrang takot.

2. Luluwas ako sa Maynila sa Biyernes.

3. Football is known for its intense rivalries and passionate fan culture.

4. Tila wala siyang naririnig.

5. Nangahas siyang tumulong sa biktima ng aksidente kahit wala siyang kaalaman sa first aid.

6. Tango lang ang sinagot ni Mica. Bumaling sa akin si Maico.

7. He practices yoga for relaxation.

8. You have to push yourself to the limit if you want to succeed - no pain, no gain.

9. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

10. Bumoto ka nang ayon sa idinidikta ng iyong puso.

11. Es importante educar a los jóvenes sobre los riesgos y peligros del uso de drogas.

12. Nang siya'y mapaibabaw, sinunud-ssunod niya: dagok, dagok, dagok.

13. Mahina ang kita ng kanyang ina sa paglalabada; mahina rin ang kanyang kita sa pag-aagwador.

14. Nagkakaisa ang aming angkan sa pagpapahalaga sa edukasyon.

15. A lot of rain caused flooding in the streets.

16. Palibhasa ay marunong magpakumbaba kahit na mas matalino siya kaysa sa iba.

17. An omelette is a dish made from beaten eggs cooked in a pan.

18. Sa oras na makaipon ako, bibili ako ng tiket.

19. Sa tuwing Undas, bumibisita ang mga pamilya sa sementeryo upang mag-alay ng mga dasal para sa mga yumaong kamag-anak na maaring nasa purgatoryo pa.

20. Ito ang barangay na pinamumunuan ni Datu Diliwariw.

21. ¡Feliz aniversario!

22. Time management skills are important for balancing work responsibilities and personal life.

23. Nawala yung antok ko. May pumasok na evil plan sa utak ko.

24. Sa kanyang hinagpis, tahimik na pinahid ni Lita ang luhang pumapatak sa kanyang pisngi.

25. ¿Qué planes tienes para el Día de los Enamorados?

26. Naglalaway ang mga aso sa amoy ng pagkain na inilabas sa kusina.

27. Sa dapit-hapon, madalas kaming magtungo sa park para maglaro ng frisbee.

28. El diseño inusual del edificio está llamando la atención de los arquitectos.

29. It's complicated. sagot niya.

30. Palibhasa ay mahusay sa paglutas ng mga komplikadong mga teknikal na problema.

31. Bukas na daw kami kakain sa labas.

32. Si Rizal ay naging inspirasyon sa mga Pilipino sa kanilang laban para sa kalayaan at karapatan.

33. Pagkatapos mag-apply ng pabango, ang aking sarili ay naging mabango at kaakit-akit sa amoy.

34. Pumupunta siya sa Maynila bawat buwan.

35. Sa tuwing naaalala ko ang mga masasakit na pangyayari, hindi ko mapigilang maglabas ng malalim na himutok.

36. Ah yun ba? Si Anthony, taga ibang department.

37. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

38. Puwede ba sumakay ng taksi doon?

39. Ailments can be managed through self-care practices, such as meditation or physical therapy.

40. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

41. Waring nag-aalinlangan siyang sagutin ang tanong ng guro.

42. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

43. Sa ganang iyo, dapat pa bang bigyan ng pangalawang pagkakataon ang mga nagkasala?

44. Bakit hindi nya ako ginising?

45. Kapag dapit-hapon, masarap kumain ng merienda habang nagmamasid sa sunset.

46. Napuyat ako kagabi dahil sa panonood ng k-drama.

47. Air susu dibalas air tuba.

48. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

49. Technology has also played a vital role in the field of education

50. Eine klare Gewissensentscheidung kann uns helfen, uns selbst treu zu bleiben.

Similar Words

High-definitionhighest

Recent Searches

babahighnagsusulathitikkinalimutantrycyclekalabawlibosalatincomputerebelievedhinilanatutokroonganangmagpapakabaitperanakakapuntakagyatdreamssakayepnagreplypagkatakotipagtanggolnatatapostanyagkahilinganbumalingtumigilscheduleyouthnagkakasyabulaklaksportsnagtitinginantsaabasketballupangmagtiisalituntuninpuedepakibigyanedadkatagalwakasmagagawaregularlunaskatutubodiseasestatagalganitocryptocurrency:hatingestablishgabrielnapabuntong-hininganakikilalangininominasikasonagpaalamgulatpapagalitannakatulognagpalalimkatawangiwinasiwaspagpapasaninakalangnakatapatpagkamanghakapangyarihanghikingespecializadaspagluluksapakikipagtagpovirksomheder,mang-aawitnanghahapdigayundinressourcernenakaliliyonggumagalaw-galawhalu-halomaliliitinangnaulinigankasamahesusnagdabogpangangatawanengkantadangkamiasmahiwagatemparaturaencuestasyumaokalalarohitamahahalikbumibitiwgandahanpasaherosignalmagkanopundidogumuhitnahigitannakakaanimrektanggulolumabaspamagatisinagotnakilalanapahintosmokingnapipilitannaguusapdanmarkvictorianilaosjeepneyhawakbangkangsementeryokaratulangsangasiopaopagbibiroculturescombatirlas,kutsilyomaestraroofstockikatlongmassachusettsmaghapongsampunghinamakpantalongpigilanubuhinsanapagsusulitkamalianagadhinintayasawaledpagpasokomfattendeplagasmabutiawitinturonmawalaadvertisingnababalotpalayonakabiladnatutuwagarcianenatasapinagkasundopeppysumingitbalatgardenadecuadomatikmanpagkaingnapilitangyoutubeninyotissueblazingfionabilugangamonakatingingwaritseinterestslumulusobapoykatedraltrenmadurasoutline300maghugasitongmalapadmaitimibalikspeechessinunodparty