Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nakapag-travel ako sa ibang bansa kaya masayang-masaya ako ngayon.

2. His speech emphasized the importance of being charitable in thought and action.

3. Gusto ko ng tahimik na kuwarto.

4. Les riches dépensent souvent leur argent de manière extravagante.

5. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa mga tao sa paligid natin.

6. Jacky! Pare! nakangiti niyang sabi habang papalapit kami.

7. Les encouragements et les récompenses peuvent être utilisés pour motiver les autres, mais il est important de ne pas les rendre dépendants de ces stimuli.

8. Ilang beses ka nang sumakay ng eroplano?

9. Nagsisilbi siya bilang security guard upang protektahan ang mga tao at ari-arian.

10. "Walang imposible basta may tiyaga," ani ng isang matagumpay na negosyante.

11. Sa naglalatang na poot.

12. Nang tayo'y pinagtagpo.

13. Ano ang ginagawa niya sa gabi?)

14. Ang snob naman neto. Alam mo ba kung anong oras na?

15. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

16. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

17. Dito ang mga lalaki at doon ang mga babae.

18. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

19. Mahirap mahalin ang isang taong mailap at hindi nagpapakita ng tunay na damdamin.

20. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

21. Pumasok po sa restawran ang tatlong lalaki.

22. El agua se utiliza en actividades recreativas, como la natación, el surf y la navegación.

23. Kailangan nating magbigay ng halaga sa mga kababawang bagay upang mag-enjoy sa buhay, pero hindi dapat ito maging priority.

24. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

25. Sa pook na iyon, sa nakaririmarim na pook na iyon, aba ang pagtingin sa kanila.

26. Isang umaga habang si Nicolas ay nasa paaralan ay nabalitaan niya na paalis na sina Helena papunta sa ibang bansa mamayang hapon.

27. Bilang paglilinaw, ang parangal ay ibibigay sa buong grupo, hindi lamang sa isang tao.

28. Nasa banyo siya nang biglang nabigla sa tunog ng pagbagsak ng isang kahon.

29. La música española es rica en historia y diversidad, con una variedad de géneros y estilos

30. Nanalo siya sa song-writing contest.

31. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

32. Smoking cessation can have positive impacts on the environment, as cigarette butts and packaging contribute to litter and environmental pollution.

33. Sa pamamagitan ng pag-aaral ng kasaysayan, mas naging malalim ang aking kamalayan sa mga pangyayari noong panahon ng Digmaang Pandaigdig II.

34. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

35. Sa facebook ay madami akong kaibigan.

36. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

37. Ang mga ibon ay wala nga namang mga pangil tulad nila kaya isinama din nila ito sa pagdiriwang.

38. Isang araw ay umuwi si Ana sa kaniyang magulang niya.

39. Like a diamond in the sky.

40. La habilidad de Da Vinci para dibujar con gran detalle y realismo es impresionante.

41. Ang pagbabayad ng utang sa tamang panahon ay nagpapakita ng katapatan sa pagbabayad ng mga utang at magiging magandang rekord sa credit score.

42. Sa isang linggo ay pupunta kami sa Japan.

43. Ang pag-akyat ng presyo ng mga bilihin ay nagdulot ng masusing pag-aalala at ikinalulungkot ng maraming pamilya.

44. Sa bawat panaghoy ng mga ina, umaasa silang magkakaroon ng katarungan ang kanilang mga anak.

45. La pobreza afecta no solo a las personas, sino también a las comunidades enteras.

46. Hindi ko alam kung paano ko malalampasan ang aking mga agam-agam tungkol sa aking trabaho.

47. Las labradoras son excelentes perros de trabajo y se utilizan a menudo en búsqueda y rescate.

48. Ang pagkakahuli sa salarin ay nagdulot ng kaluwagan sa mga biktima at kanilang pamilya.

49. Na-curious ako kaya't nag-google na lang ako upang malaman ang sagot.

50. Sa kabila ng hirap, ang kanyang loob ay hindi kailanman naging mababa.

Similar Words

High-definitionhighest

Recent Searches

highngpuntaakinmangyariilanbilihinmaintindihanpatricklimitpinagsikapanpagkalungkotsharmainemagbagong-anyonaglalaronakalilipasfotosnaglipanangnapatawagnangangahoymagkaibigannagtagisanwriteamendmentstinigelementarybethutakkinakabahannapaiyakbatasumagotmaatimdekorasyonnagnakawnakapaligidunti-untinananalopagtataposmagamotmasasabibibigyanhulihandiscipliner,makasilongipinikitisasabaduusapanlumutangpoongvidenskabpangungusappagtinginkuwentorektanggulogiyeramagtakakolehiyonagdadasaldesisyonannangyarikinumutanna-fundtulisannahigitanmamanhikanpakukuluansinisiracommercialdiinkapitbahaynabigkaspakistandepartmentpaglayasriegakaratulangtinuturokontramasungitkastilaexigentetanyagbiglaaninstitucionesmarinigdisciplinmalawakmanonooddyosaipinambilimandirigmangkaragatanbuwayafederalumagasumasaliwpaggawaabutankulisapmissiontusindvisexpresanhoysalbahehinabolaguabalinganbalotlarongklasengstocksmatapangincidencelayawvivakinseibinalitang1950sutilizaraffiliatedissecarbonmulighederparigamitinassociationsinimulanexhaustedhuwebessumigawalamidpangingimiprincehojasboracayisinalangmrsmorenagraphicmaitimsystematisklamesabriefbrindarulamseriouswalngnanghihinamadwelldayssinabiglobalfeelchavitklimafireworksharmfulfistsencountersumanggameslatercompartenmuchosferrerkartonpersonsbosesratesagingmainithardtamadwastonalugibehaviorinteligentesfrogsafetelevisedstatepitobilaonalakitangeksumagawpaghihiraplandegayunmangayundinkaninotinataluntonmakaiponanibersaryopaakyatmaghapontibignaalisnaglabananpulis