Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. They organized a marathon, with all proceeds going to charitable causes.

2. The victim was able to identify the culprit who had been harassing them for months.

3. The objective of football is to score goals by kicking the ball into the opposing team's net.

4. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

5. Maraming bansa ang nagsimula ng digmaan dahil sa territorial disputes.

6. Napansin ng Buto na nagsipagtago ang mga hayop sa mga kuweba.

7. Pagkatapos siyang kausapin ng hari ay dumeretso si Nicolas sa simbahan at siya ay nagdasal.

8. Proses kelahiran di Indonesia umumnya dilakukan di rumah sakit atau pusat kesehatan masyarakat (Puskesmas).

9. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

10. Ano ba pinagsasabi mo! Baliw ka ba! Umalis ka nga!

11. Nakukulili na ang kanyang tainga.

12. Nasi kuning adalah nasi kuning yang biasa disajikan pada acara-acara tertentu dan dihidangkan dengan berbagai lauk.

13. Ang mahiwagang pagsagot ng prinsipeng tila ba mag agam-agam.

14. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

15. Sa katagalan, natanggap na niya ang panunuksong ito.

16. Sino ba talaga ang tatay mo?

17. Amazon started as an online bookstore, but it has since expanded into other areas.

18. "You can't teach an old dog new tricks."

19. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

20. Ang kanyang malalim na pangarap ay animo'y imposibleng maabot ngunit patuloy pa rin siyang nagsusumikap.

21. La habilidad de Leonardo da Vinci para crear una ilusión de profundidad en sus pinturas fue una de sus mayores aportaciones al arte.

22. Ang dami nang views nito sa youtube.

23. Hirap sa inyo ay sabad kayo nang sabad, e, sabi ng pulis

24. Erfaring har lært mig at tage ansvar og være proaktiv.

25. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

26. Tumingin siya saken at sa malungkot na mukah ay umiling.

27. En invierno, las temperaturas suelen ser bajas y el clima es más fresco.

28. Limitations can be a source of motivation to push oneself to achieve more.

29. The dog barks at strangers.

30. Bakit ganyan buhok mo?

31. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

32. Naglaro sa palaruan ang mga bata nang limahan.

33. Ese vestido rojo te está llamando la atención.

34. Hindi sapat ang maging bukas palad lamang sa panahon ng kapakanan, dapat bukas palad ka rin sa panahon ng kahirapan.

35. Ang bilis ng internet sa Singapore!

36. Walang password ang wifi ng kapit-bahay.

37. I am not listening to music right now.

38. Naaksidente si Juan sa Katipunan

39. Masyadong mahal ang kanyang gustong bilhin, samakatuwid, naghanap siya ng mas murang alternatibo.

40. Kahit mayroon akong mga agam-agam, hindi ko ito dapat ikumpara sa iba dahil may kanya-kanyang paghihirap ang bawat isa.

41. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

42. She admires her mentor's leadership skills and work ethic.

43. Madalas na mayroong propaganda sa panahon ng digmaan upang mapalawak ang suporta ng mamamayan.

44. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

45. Hindi ko ho makain dahil napakaalat.

46. Naku wala yun, pagngiti ko dun sa babae.

47. Ah opo, ngayon ko lang napagtanto ng sinabi nya yun.

48. Tinuruan niya ang kanyang anak na maging magalang sa mga nakatatanda.

49. Ang pagkakaroon ng positibong pananaw ay makatutulong sa pagharap sa mga hamon ng buhay, samakatuwid.

50. Naku, wala ka naming gagawin sa Davao.

Similar Words

High-definitionhighest

Recent Searches

highnoonmag-ingatxviimalungkotchickenpoxtumugtogcalidadprinsipengpaglingamadamidinukotpagitankasichambersayonmaarioutlinesayusinnamangangkingpamamagitanpasalamatanmetodisknagpuntakamaojunjunkinikilalangdumikitnakakapamasyaldalawmakapagsabiipinatawchartskarnenagpa-photocopymonumentopaksabinabatiadobomagsalitanagandahanmanirahanfaceanimoyrightsdaymahalmabaitmaliitmakuhanapilitangumiinitpagpapakilalaanibirodaysscientistsumasakaysumarapinagawsumusunosukatingovernorskaibigannaglalarosamantalangnananaghilinakangisingexigenteadvancedsaranggolakasaganaannakapangasawadisenyoincluirkasamaannagtatrabahotiyannagbiyayaespecializadassumasaliwpagtitiponpaggawaiigibnaiwanglinggongpagkatakotgumawatambayanniyalupangmaglabayanlabahincelularestransportationsentencealmacenartresbingihdtvdyipiskonagdarasalspecializeddalawabinasatransmitidasbalancesakomamicomplicatedthingstumikimsportsplacesagingkasinggandafistsbehaviortechnologicalsambitinteligentesbowitlogkawalanpinilinghatingkaloobannaiinggitt-shirtsourcediscoveredpinipilituriumuwiupworklabicongressninyonghalu-halopagtiisanhiyaworkdaysunbilanggonapapansinlintajansagotnakapikitharapinyumanigsupilinnaglokohannamanghabinabaratsinehancriticsioshitaannikanananalokontingngunitnagbungamatapobrengbaitmatuklapnauliniganmonsignorrequireinnovationngapinagwikaanlumagoaddresshila-agawanindiaroomevolucionadofactoresre-reviewusuariotahimikkatabingleytemaskmallburmagrewyakapinpuntamakessquatterrawendhimandyan