Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Baby fever can affect people of various ages, backgrounds, and genders.

2. nadama niya ang bagong tuklas na lakas niyon.

3. Magdidisko kami sa makalawa ng gabi.

4. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

5. Sa bawat kompetisyon, dala ni Hidilyn Diaz ang pagmamalaki at pagmamahal niya sa Pilipinas.

6. Las hojas de té son muy saludables y contienen antioxidantes.

7. They go to the library to borrow books.

8. Nakita niya ang nagbabagang bulkan mula sa malayo, nagpapakita ng lakas ng kalikasan.

9. Muchas ciudades tienen festivales de música que atraen a personas de todo el mundo.

10. Nagpalipad ng saranggola si Juan sa bukirin.

11. Itinago ni Luz ang libro sa aparador.

12. Cada nacimiento es único y especial, con su propia historia y circunstancias.

13. Madalas syang sumali sa poster making contest.

14. Nakita ko ang mga kapatid ko noong pasko.

15.

16. Crush kita simula pa noong nakita kita sa klase natin.

17. Masarap ang pagkakaluto mo ng kare-kare.

18. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

19. Bumili ako ng lapis sa tindahan

20. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

21. Paano ako pupunta sa Intramuros?

22. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

23. Ang mga hardin sa mga pribadong sityo ay ipinapalagay na mayabong at nag-aalok ng kaginhawahan.

24. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

25. Oo naman! Idol ko si spongebob eh.

26. Ang mga mag-aaral ay nag-aapuhap ng karagdagang oras para mag-ensayo para sa kanilang mga pagsusulit.

27. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

28. I have a craving for a piece of cake with a cup of coffee.

29. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

30. Today is my birthday!

31. How I wonder what you are.

32. My girlfriend looked like a beautiful lady when she walked down the stairs in her new dress.

33. Climbing to the top of a mountain can create a sense of euphoria and achievement.

34. May meeting daw ang lahat ng guro kaya't kami ay maagang pinauwi.

35. Les maladies chroniques telles que l'asthme, l'arthrite et le syndrome de fatigue chronique peuvent affecter la qualité de vie d'une personne.

36. Sa tagal nilang nagsama ay hindi sila pinalad magkaroon ng anak

37. Umayos naman ako ng higa at yumakap patalikod sa kanya.

38. Sa panahon ng pandemya, maraming tao ang naging nag-iisa dahil sa lockdown.

39. Sa lilim ng kanyang sombrero, tahimik na nagmamasid si Lola habang binabaybay namin ang kalsada.

40. The pneumonia vaccine is recommended for those over the age of 65.

41. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

42. Mayroon umano siyang lihim na kayamanan na itinago sa loob ng maraming taon.

43. Protecting the environment involves preserving natural resources and reducing waste.

44. Kinuha ko yung CP niya sa bedside table.

45. Napagkasunduan ng grupo na i-expel ang miyembro na na-suway sa kanilang code of conduct.

46. Pumasok ako sa isang malaking kuwarto na halos hindi ko makita dahil sa sobrang pagdidilim ng mga ilaw.

47. Siya ang aking kaulayaw sa lahat ng bagay.

48. Hindi ba nagdaramdam ang nanay at tatay mo?

49. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

50. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

Similar Words

High-definitionhighest

Recent Searches

yonhightargetrolewayspossibleresponsiblebubongkasinggandaidea:expectationsmainittilivaliosabumaligtadkasalukuyanclockwhilebitbitmotionwhichfrogedit:squattereasydumalocommunicatesofaumilingdermakakainbisigkilaykahitsanapagkakatuwaannakaka-inpakikipagtagpokasiyahangusting-gustoniyandilakapatawarannamulaklakhila-agawanvirksomhedernagtataashinimas-himasinferioresmonsignorhumahangospaumanhincrucialnakaraannaulinigannakadapamaisisinalangactualidadpamasahenakahuglumuwasnagwagicalidadkargahanhandaankaninopatakbopaghuhugasnanunuksoyumaokapagmakaiponsandwichtalaganggirayniyomasiyadokambingpublicitylilipadumibigberetiairconcnicoinvitationparurusahandumaanmalayangmapahamaksumuotpasalamatanchoinilulonsinampalklasrumpunsogoshpalayansafefar-reachingclientsadverseorderinbaroplaysritwalfreelancerdeathiiwasanhoweverpapuntagotincreasessamaikinamataypinakamatabangnagtitindanamumuonggabi-gabinag-aalanganmagagandangturismokumaliwanagtutulakpaglalayagmaihaharappanghabambuhaynasasakupanpagkahapomagtiwalateknologimagulayawkalalaroiconiclumikhamakasilongnakatapatinaabutanminamahalkasayawuulaminpagsubokitinatapatmagtakamamalasmakakabalikumuwiadgangvillagekinalalagyanmagpagupitmontrealpacienciataga-hiroshimanakakamitexhaustionnangangalitsulyapnakakarinignangahaspakukuluandadalawstoryumiyakpananglawibinaonkuripotautomatiskmagsungitpoorertapusinsiyudadsementonglolasarisaringtherapeuticsanumangbakantenakangisingpawisikatlonggatassuriinporkalarominervieniyoghumihingigalaannewspapersbagamanapilitanghabitinastadadalobumangonheartbeattawanantusong