Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang mga magsasaka sa kanayunan ay nag-aapuhap ng suporta mula sa gobyerno para sa kanilang mga pananim.

2. The power of a single act of kindness can be immeasurable in its impact.

3. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

4. Palibhasa'y walang kalaro, ang mga hayop na lang ang ginawang libangan nito.

5. Salamat po at pinagbigyan nyo ako.

6. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

7. Ngumiti siya sa akin saka nagsalita.

8. Hindi ko alam kung paano ko sasabihin, pero crush kita.

9. Dapat pa nating higpitan ang seguridad ng establisimyento, mungkahi naman ng manager.

10. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

11. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

12. Les devises étrangères sont souvent utilisées dans les transactions internationales.

13. Oh, kinaiinisan mo pala? Eh bakit naging paborito mo?

14. Maraming bayani ang nagbigay ng kanilang buhay upang makamit ang kalayaan ng bansa.

15. La calidad del suelo es un factor clave para el éxito de los agricultores.

16. Si Leah ay kapatid ni Lito.

17. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

18. Los padres experimentan una mezcla de emociones durante el nacimiento de su hijo.

19. El invierno es la estación más fría del año.

20. Les patients sont souvent admis à l'hôpital pour recevoir des soins médicaux.

21. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

22. At malaman ng maaga ang wasto sa kamalian.

23. Sa tuwing pinagmamalupitan ako, lumalalim ang poot at humahantong sa galit.

24. Every cloud has a silver lining

25. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

26. Ang ganda naman ng bago mong cellphone.

27. También es conocido por la creación de la Capilla Sixtina en el Vaticano.

28. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

29. Ang paglutas ng mga palaisipan ay hindi lamang tungkol sa pagpapakita ng katangian ng isang indibidwal, kundi tungkol din sa pagpapakita ng kahalagahan ng malawak na kaalaman.

30. Sa pagguhit, hindi kailangan na perpekto ang mga linya at kulay mo.

31. Landet er et godt eksempel på, hvordan man kan skabe en velfungerende

32. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

33. Pumasok sa sinehan ang mga manonood nang limahan.

34. Hindi umimik si Aling Marta habang minamasdan ang bata.

35. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

36. Jacky! napalingon ako ng marinig ko ang boses ni Aya.

37. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

38. At blive kvinde kan også betyde at finde sin plads i samfundet og i verden.

39. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

40. Pare-pareho talaga kayo mga babaero!

41. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

42. Ipantalop mo ng kamote ang kutsilyo.

43. Nagising na si Angelica matapos syang operahan sa loob ng limang oras.

44. Dapat niyo akong pagsilbihan dahil dito.

45. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

46. Wag kang tumabi sakin! paguutos nito.

47. Laganap ang paggamit ng social media sa kabataan ngayon.

48. Magkikita kami bukas ng tanghali.

49. Buhay ay di ganyan.

50. Sa pamamagitan ng pagkuha ng mahusay na tulog, ang aking pagkapagod ay napawi at nagkaroon ako ng sariwang enerhiya.

Similar Words

High-definitionhighest

Recent Searches

pinunithighkristomensajeskuwadernotilaadvertisingpartnerbituinpag-aralincoaching:dalandankumbentotopicnakatagoikinagagalakkumalat1977facebooksinopagkaawanitongtalagangmisteryosiguradomalagotreatstrentamagsusunuranpeppymag-inamapagbigayautomatiserebatangnayondali-dalilasingpagmasdannaglahongagesbagamatlargesumasambahindeedsaprogramming,computerpootpakibigaymangingibiggagnaglalakadthroatangkantalagacaracterizade-latapuedesnagtatanongirogconcernmatabagayunmanmediajobsjoshkasamaanhumigahumiwacombinedkailannagsusulatgoodeveningpumuntaexpeditedkalanmayananaignagre-reviewlumingonayantambayannagtinginandiseasesmaihaharapplatformtawanangagamitgamesmayamanh-hoymahusaypassionsidopanunuksohumakbangpagsumamopumitasininomsiempreglobekinauupuangkanilanahigitanthereforemasyadongpicsantibioticst-shirttumikimsharepalabuy-laboysalesgapinalagaannakayukopamahalaananimoypagluluksamagdaraosmaykasalukuyanukol-kaygotnakapagreklamofathermagasawangnahigaissuesmariomakahiramlipadabaladiretsoparkingnapatakbosurveysbook:pundidopinagkaloobannakakalayogreatthroughoutisangmagingambisyosangnagbigayanbiocombustiblesdumiinaabutanibinalitangnakapaligidmagwawalatumibaysportskilayfuelsolarhimigtinaynagmadalitiniklingbansanghistoriapangarapnapakabagalmakapalkangkongrobinhoodteknologiyumuyukosimpelmalinisnapuyatattentiontaglagasuwakkinalilibinganbedsidemasayangtumapostieneraiseimulatbotantemakabawimagdaopisinabilibidmathmag-ingatnananalongulobiyahepapalapitbigkisnilutoumaapawpicturemakapagempake