Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Pinagalitan niya ang matanda at tinulak-tulak ito.

2. At tilgive os selv og andre kan være afgørende for at have en sund samvittighed.

3. Napilitan silang magtipid ng tubig dahil sa patuloy na tagtuyot.

4. El nuevo libro de la autora está llamando la atención de los lectores.

5. Limitations can be frustrating and may cause feelings of disappointment and failure.

6. Patawarin niyo po ako, nagpadala ako sa mga pagsubok.

7. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

8. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

9. Pinagsisihan niya ang mga desisyon na hinugot niya mula sa kanyang emosyon.

10. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

11. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

12. El romero es una hierba aromática que se usa frecuentemente en la cocina mediterránea.

13. Hindi ko kayang magpanggap dahil ayokong maging isang taong nagpaplastikan.

14. Pakipuntahan mo si Maria sa kusina.

15. Emphasis is often used in advertising and marketing to draw attention to products or services.

16. Dapat natin itong ipagtanggol.

17. Sino ang sumakay ng eroplano?

18. Give someone the benefit of the doubt

19. Kadarating mo pa lamang, Ogor, nais niyang itutol.

20. nakita niya ang naghuhumindig na anyo ni Ogor.

21. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

22. Hinila na ni Kirby si Athena papunta sa table namin.

23. Kumirot ang dibdib ko sa naisip.

24. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

25. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

26. Smoking cessation can have positive impacts on the environment, as cigarette butts and packaging contribute to litter and environmental pollution.

27. Que tengas un buen viaje

28. Thor possesses god-like strength and wields a powerful hammer called Mjolnir.

29. Para sa anak ni Consuelo ang T-shirt.

30. We have a lot of work to do before the deadline.

31. Kapag dapit-hapon, masarap kumain ng merienda habang nagmamasid sa sunset.

32. Hindi ako sang-ayon sa mga kuro-kuro ng ilang mga pulitiko.

33. Dahil sa mga kakulangan at risk na nakikita ko, hindi ako pumapayag sa kanilang plano kaya ako ay tumututol.

34. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

35. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

36.

37. Pagkat ikaw ay bata at wala pang nalalaman.

38. Sino ang kasama niyang nagbakasyon?

39. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

40. He is not watching a movie tonight.

41. The chef created a series of dishes, showcasing different flavors and textures.

42. Napansin niya ang mababa ang kita ng tindahan nitong buwan.

43. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

44. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

45. Saan nagtapos ng kolehiyo si Peter?

46. Kung may tiyaga, may nilaga.

47. Patuloy ang labanan buong araw.

48. Kailangan ko ng pliers, puwede ko bang hiramin ang iyong tools?

49. Aray! Bakit mo ako sinapak! Potaena mo naman!

50. Nag-iisa man siya, hindi siya nawawalan ng pag-asa.

Similar Words

High-definitionhighest

Recent Searches

eksamhighsulinganbulatopic,alethereforesystemandreinformedwhetherinteriorcontentviewcontrolledflashpublishedmakapilingdoingtablecuandoerrors,continuewaitpronounlumalaonnaglipanangmumuraexperience,matiwasaynagtutulaknaglalaropagtataposnagpalalimnangangaralnapasigawkainankumidlatpangangatawanstorymanatilinaglutomilyonge-booksroofstockaayusinbalikatpaglayasbiglaanpokernamanpagkaingmariepaggawapinagsanglaanreynabestidatomorrowpamangkingranadautilizarpaticonventionalbatoktresownbumuhosmadalingkasiyahangdaysbernardocomienzanbumabarolepinunitserbastainteligentesappconsideredpanguloyunkagandahageskuwelahantinatawagmagkaharapculturegetaktibistanaturalkabuhayannapasubsobmateryalestumatanglawmagawamarketingmakawalahinukaybutterflytungoflamencomauntoglupainhinugotmaalwangadmiredmaatimnasabingtalinoabamahuhulidireksyonbooksinantokmasdanbigongkagubatanreservationpumuntacomekumarimotqualityreadinggoingpinagmamasdandulokasingbetadependingcertainfutureprocessesjunjunsalapiconnectionthirdrangesolidifysyncintelligencemakitajuanitopupuntainvitationmusicianpagtatanongtamispagsasayanakaririmarimhinawakannewsdahan-dahannalagutanmaaksidentemaligayatuwangninasalubongmaliitpaperpagstreetnagbabalaundeniablehitkainitanbumibitiwmagpapagupitemnerpamumunolumamangpinapakainutilizanmalilimutanregalolikasnogensindegumuhitpusasantostodasiniwankatulongtanggapinasthmakumukuhanagisingkamustanuhparkelifebutihingdadspareumingitsumusunonatalotheirleyteipagbili