Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang pagdarasal o meditasyon ay nakagagamot sa aking kalooban at nagbibigay ng kapayapaan.

2. Samantala sa malayong lugar, nagmamasid siya ng mga bituin sa kalangitan.

3. Sa sobrang dami ng mga dapat gawin, may mga pagkakataon na naglilimot siya sa ilang mga mahahalagang mga takdang-aralin.

4. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

5. Humahaba rin ang kaniyang buhok.

6. Ang pagsama sa kalikasan ay nagdudulot ng isang matiwasay na kalooban.

7. He is typing on his computer.

8. Saan nagtapos ng kolehiyo si Peter?

9. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

10. Nagkalat ang mga balat ng prutas kahit saan.

11. Repeated frustration can lead to feelings of hopelessness or helplessness.

12. They do not eat meat.

13. Las fiestas invernales, como el Día de Reyes, traen alegría y celebraciones.

14. Después de estudiar durante horas, necesito un descanso.

15. Siya ang aking kaulayaw sa lahat ng bagay.

16. Gawa ang palda sa bansang Hapon.

17. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

18. Nationalism has been used to mobilize people in times of war and crisis.

19. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

20. Parang gusto ko nang magka-baby. pagkuwan eh sabi niya.

21. A veces es difícil encontrar buenos amigos, pero cuando los encontramos, vale la pena.

22. The actor received a hefty fee for their role in the blockbuster movie.

23. Emphasis can be used to create rhythm and cadence in language.

24. Madaming squatter sa maynila.

25. The legislative branch, represented by the US

26. Magandang umaga po. Ako po si Katie.

27. Maraming iba-ibang kulay na ilaw sa parke.

28. Ang sugal ay maaaring magdulot ng labis na stress, pagkabalisa, at pagkabahala sa mga manlalaro.

29. La labradora de mi hermana es muy cariñosa y siempre está buscando atención.

30. Je suis en train de manger une pomme.

31. Hindi ko malilimutan ang pagkanta namin ng "Hindi Kita Malilimutan" ng Bukas Palad sa aking graduation.

32. Karaniwan sa kasal, mayroong seremonya ng pamamahagi ng singsing at pagbibigay ng halik sa asawa.

33. Ang tarangkahan ng aming tahanan ay kulay pula.

34. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

35. I caught my boyfriend staring at a picture of a pretty lady on his phone.

36. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

37. Ku, e, magkano naman ang laman? ang tanong nga babae

38. This has led to increased trade and commerce, as well as greater mobility for individuals

39. Ang bola ay gumulong pababa sa hagdan.

40. Mathematics has many practical applications, such as in finance, engineering, and computer science.

41. Salatin mo ang mga butones ng remote upang mahanap ang tamang pindutan.

42. Sinalat niya ang kanyang bulsa ngunit wala roon ang kanyang cellphone.

43. I have finished my homework.

44. Paano mo pinalambot ang giniling na karne?

45. Sa dapit-hapon, madalas kaming magtungo sa park para maglaro ng frisbee.

46. Las serpientes son animales de sangre fría, lo que significa que dependen del ambiente para regular su temperatura corporal.

47. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

48. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

49. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

50. Oh! What a coincidence, dito ka pala nagtatrabaho?

Similar Words

High-definitionhighest

Recent Searches

highsasakyangabicountlessnagpakitamanunulatnaglulutomatangkadmaninipisnamissnakangisiincreasesexpertiseeffektivtisinampaynapatigilguidancenapangiticontinueskumikinigpasinghalnapatakboshoespinagmamalakinakatuwaanginaasahanmabihisanpagkapanalonangangalitpamangkinnakakamitdinalawnag-emailjuegosmisyunerongtherapeuticskalimutanroofstockthereforeluboskuboforskelpagbigyanpublicitymatipunohomemalayangailmentspunsodesigningrabecommunitychambersleadtanggapinmasyadongitaasnakangangangtumulaknilapitanmatatawagteknolohiyanaggalasangkalanbecomekumaliwaakintinamaanleoisinilanggawaingmagsungitnagtalaganagtatakasasayawinnagkapilattinawanannakaangatcelebranapaangatkalawakangatolnaiilaganwifimahahaliklansanganadditionally,sinenagsagawaawaaywanmagagandareservedyearbinabaratnatataposmatatandaasahanshiftkalagayaniphonemasayang-masayangmagtiwalakara-karakamagwawalapantallasinasikasopagkabatanagpaalamfuncionarnamumukod-tangipinagkaloobanoperasyonnapanoodumiiyakairportmakabilisocialespanamasistemasnag-uwiintroducemamulotmapagkalinganapakabagalpulongsakopganidracialenforcinglayawproductsumalispinagsasasabitransparentspeechpalayandangerouskalasingaporelarawanhumingidetectedeeeehhhhsumaliwmakulitsasagotsapatosipakitamatatagnakuhaitlogmalisanagilitymalimitligaligmaestraflerestarredmagagandangaganandoonmabangismonitortanganeffortsmaghihintayipag-alalapaglalayagpadalastoolnaturlumapadmatandangprovidecasesmayamansoportesumakitmagbubukidkuwartoadvancelamesapintofederalteacheradvertising,magpaliwanagtonettemakakasahodpinahalataundeniabledumikitactualidadyumanigalanganpusingboksingtawarequieren