Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Electric cars can help reduce dependence on foreign oil and promote energy independence.

2. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

3. Ang kagutuman ay laganap sa mga lugar na may kalamidad.

4. Naglakad kami sa gubat na mayabong ng mga punong-kahoy, at naramdaman namin ang sariwang hangin.

5. Tumawag ako kaninang umaga pero wala ka.

6. Napabuntong-hininga siya nang makitang kinakawitan na ni Ogor ang mga balde.

7. Nagtago kami sa lilim ng malaking bato habang naghihintay sa pagtatapos ng ulan.

8. Women have made significant strides in breaking through glass ceilings in various industries and professions.

9. Nabagalan ako sa takbo ng programa.

10. La música puede ser utilizada para transmitir emociones y mensajes.

11. Nasa likuran lamang niya ang nagsalita.

12. Itinali ng hari ang batang higante at pinakawalan ang mga taong nakakulong sa kuweba.

13. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

14. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

15. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

16. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

17. Bukas na bukas din ay kakain tayo sa labas.

18. The blades of scissors are typically made of stainless steel or other durable materials.

19. Ang biglang pagtawag ng alarm ay binulabog ang katahimikan ng gabi.

20. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

21. Sigurado na siyang walang panalo sa kanya ang matanda.

22. The project was behind schedule, and therefore extra resources were allocated.

23. Kleine Geschenke erhalten die Freundschaft.

24. Maaaring balang araw ay magkaroon din siya ng mamanuganging may sinasabi rin naman

25. Pupunta ako sa opisina ko sa Makati.

26. Muchas serpientes venenosas poseen colmillos huecos a través de los cuales inyectan veneno en sus presas.

27. Umupo sa harapan ng klase ang mga mag-aaral nang limahan.

28. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

29. Ilang araw ang reservation natin sa hotel?

30. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

31. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

32. Ang bahay ni Lola ay palaging mabango dahil sa mga bulaklak na nasa hardin.

33. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

34. Bumili ako ng blusa sa Liberty Mall

35. Drømme kan være en kilde til trøst og håb i svære tider.

36. Napatunayan nilang lason ang mga bunga nang isang araw ay may napadpad na manlalakbay sa kanilang bayan.

37. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

38. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

39. Foreclosed properties can be a good option for first-time homebuyers who are looking for a bargain.

40. Buwal ang lahat ng baldeng nalalabi sa pila.

41. Pumuslit ang luha sa sulok ng kanyang mga mata.

42. He has been hiking in the mountains for two days.

43. TikTok has faced controversy over its data privacy policies and potential security risks.

44. Bawal magpakalat ng mga paninira sa kapwa dahil ito ay labag sa moralidad at etika.

45. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

46. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

47. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

48. Ang ganda naman nya, sana-all!

49. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

50. Ang pagiging malilimutin ni Ana ay laging nagdadala ng problema sa kanilang grupo.

Similar Words

High-definitionhighest

Recent Searches

hinalungkathighkapangyarihantravelerbayadexitdapit-haponpagpapakilalaeskuwelaatelanghagdancashanongmabilispublishingmarketingnakabilikapatidlumalakikikitasisikathelpbayangnasiyahancardparkenahuhumalingkilalamay-bahaysakupingamitintungkolconectansofabroadcastingskypesagingnagwikangredigeringmultodontfireworkssalapaghalakhakgamestumangodreweconomytelefonprincipaleskabuntisankapangyarihangopgaver,zoomcornersmartesnagpapaigibtaxikalalarolifeipaghugaskondisyondreampinilingoktubrebasketballbisitaumanopinagtagpomagdamaganginhawascientistcreatenginingisihanmagbagong-anyospendingautomatisknakatunghaybulongtomtennisdesisyonannagsilapitmahahabakasingitinaliasahanpapanhiknapakamisteryosorepublicanairportcultureumingitmahinagubatdollylawaytsinelaslaruintaga-nayonditoalikabukinyatalayunincleangayunpamanpulisisinaraentertainmentwarisundhedspleje,eneronakabibingingmaranasananiyaafterilalagaykinatatalungkuangtinangkaginagawamadurastaga-hiroshimapinakabatangpakikipagbabagkumanandalawangtotooduonpatakbocrecerfencingbansanginintaynagpalalimapatnapucalciumcomienzanliligawantumalontasaoutpostnavigationflexiblepowerspangangatawanpublishedpinalakingfatalincludefe-facebooknagmamaktolkutsaritangkanayangroofstocknaghuhumindigbunutannakalockpagpapatubopaghaharutanbilugangbayawakbiyernesbusydamitbecomingtienennagtitindamatamissiyang-siyachoiceexperience,granadabagamaumaagosgumagamitnakakarinigkablanarawalintuntuninredpebrerokumaliwalaloschoolsdadalobernardoexcuseprincebinatakhimselfkantalinoanyokumidlatalakcharitablebiglaituturomaistorbo