Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

2. Marami ang nagpasalamat dahil hindi naging kamukha ng sanggol ang kanyang ama at ina.

3. The mission was labeled as risky, but the team decided to proceed.

4. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

5. Anong tara na?! Hindi pa tapos ang palabas.

6. Unser Gewissen kann uns vor schlechten Entscheidungen bewahren und uns auf den richtigen Weg führen.

7. Kapag nagkakasama-sama ang pamilya, malakas ang kapangyarihan.

8. The feeling of finishing a challenging book can be euphoric and satisfying.

9. Hindi ko ho makain dahil napakaalat.

10. Malinis na bansa ang bansang Hapon.

11. Pumunta ako sa Iloilo noong tag-araw.

12. Ang lakas mo kumain para kang buwaya.

13. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

14. The policeman directed the flow of traffic during the parade.

15. Det danske økonomisystem er kendt for sin høje grad af velstand og velfærd

16. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

17. Agad agad din syang tumalikod at tumakbo...

18. Sayang, kapan kita bisa bertemu lagi? (Darling, when can we meet again?)

19. Ang oxygen ay kailangan ng tao para mabuhay.

20. Handa na bang gumala.

21. Siya ay nagpunta sa simbahan, lumuhod, at nagdasal.

22. Gusto ko na talaga mamasyal sa Singapore.

23. Bumibili si Rico ng pantalon sa mall.

24. Ano ang nasa bag ni Cynthia?

25. Cutting corners in your exercise routine can lead to injuries or poor results.

26. Napunit ang papel ng saranggola dahil sa malakas na hangin.

27. Walang anak sina Mang Kandoy kaya't ganoon na lamang ang dasal nila sa Panginoon upang mabigyan sila ng anak.

28. Transkønnede personer kan opleve udfordringer i forhold til sundhedspleje og adgang til passende behandling.

29. Maya-maya, muling naupo at dumukot ng isang lapis at isang maliit na kuwaderno sa kanyang bulsa.

30. Pinigilan nya ang mga kamay ko, Wag!

31.

32.

33. Si Carlos Yulo ang naging inspirasyon sa pagbuhay muli ng gymnastics program sa Pilipinas.

34. Nakasandig ang ulo sa tagpiang dingding.

35. Maraming bansa ang nagkakaisa upang magbigay ng tulong sa mga bansang naapektuhan ng digmaan.

36. Sa dakong huli, naitama ko rin ang aking mali sa trabaho.

37. Si prince charming yan noh? pang-aasar ko.

38. Masarap higupin ang sinigang na may maraming gulay.

39. Hindi ko nais makialam, ngunit sa ganang iyo, tama ba ang naging hatol ng hukuman?

40. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

41. Einstein was known for his sense of humor and his love of sailing.

42. Inflation kann die Beziehungen zwischen den Ländern beeinträchtigen.

43. Ang guro ang pinagpalaluan ng lahat ng kanyang mga estudyante dahil sa kanyang kabaitan.

44. Masasabi ko na ang mga kanta ng Bukas Palad ay nagbibigay sa akin ng kapayapaan at kapanatagan.

45. Ang kanyang pagkanta ay animo'y pumapasok sa puso ng mga nakikinig.

46. Hindi masikmura ni Manuel na ang binibigay na pera ng ilang pulitiko ay galing sa kasamaan.

47. Ang mga batas tungkol sa paggamit ng droga ay mahalaga upang maiwasan ang mga krimen na may kinalaman sa droga.

48. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

49. All these years, I have been grateful for the journey and excited for what the future holds.

50. Hindi ko akalaing capable ka palang tumawa.

Similar Words

High-definitionhighest

Recent Searches

highlikelynothinghimselfbawatappbaldengstartedwritemethodskasogayunmanmalapitangayundinmidtermproducts:litomakahiramfar-reachingnagmasaktanpaaarawenfermedades,seguridadskillsmabihisandoble-karaabapangilsinasabiayaluisacupidmatsingtumatawaplaguedsquashbilindrinktessdevelopkalalarokaliwaworkmariatumatawadskyldesbingomusicalhalamangregalomaasimwalangestadosnapabalitareachoutmapapalatekamaaguadalhanikinagagalakkalagayanmagpa-checkuptambayannakitulognicomasasalubongisinasamadingdingnapabalikwassimbahanrecentlykargangbalangrefnasimpitnakatinginbusiness,pagluluksapakakasalananimales,knowledgepakibigyankawayanmasterbintanapaglulutoeleksyonestablishnag-umpisabopolsnagtungodesarrollarontandangmasdanmaalalautusannakaratingmag-alasnapakalamigcornersnabasamahulogdumilimsuelobagyongtaga-lupanggobernadorhinahaplossanmagandang-magandadevelopmentreceptornagkakasayahanpadalasmabalikgusting-gustomaka-yostruggledpagkaimpaktonag-emailmakaratingrestawranmaalikabokyumaoginooagam-agamclientstanyagdanmarkdeletingranaynakalocknaaalalakatipunanibat-ibangpaungolconbayadnakiisawonderneromalimittanawinkinalalagyanmasaganangsanangpagkabiglatradisyonumibiginventedbigayyakapnakakaennakarinigmapagkatiwalaanyanutak-biyarenombrepalakanakapagproposebefolkningen,kakainkadalaspabalingatmahiwagangpagpapakainkawalanandyanbusyubuhinpaghahabiperlatrapikpesosisasamamasipaggananginordernag-alalakulturpasalubonglasdapit-haponmonitormagbigaymediaprovidedteachingsspansbihasakinabukasaninspiredprimerasmaglalabingnagpagupit