Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1.

2. Sa kanyang pagda-drive, nabigla siya nang biglang tumawid ng daan ang isang pusa.

3. El agricultor cultiva la tierra y produce alimentos para el consumo humano.

4. Sino ang kasama niyang nagbakasyon?

5. Lumiwanag ang silangan sa pagsikat ng araw.

6. Wala siyang dalang payong, samakatuwid, nabasa siya ng ulan.

7. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

8. Hindi ko maintindihan kung bakit kailangan pang magpaplastikan kung maaari naman nating sabihin ang totoo.

9. Tuwang tuwa siya sa mga palaka, para sa kanya ay nakakaakit ang mga malalaki at bilugang mata ng mga ito.

10. Ang paglalabas ng mga pahayag na alam na hindi totoo ay nagpapakita ng pagiging bulag sa katotohanan.

11. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

12. Hindi siya makabangon at makagawa ng gawaing bahay.

13. Mon fiancé et moi avons choisi nos alliances ensemble.

14. Ang tagtuyot ay nagdulot ng malawakang pagkamatay ng mga alagang hayop.

15. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

16. Sa bawat pagsubok, si Hidilyn Diaz ay laging naniniwala na ang pagsisikap ay susi sa tagumpay.

17. Kumain ka na ba? Tara samahan kitang kumain.

18. Anong gusto mo? pabulong na tanong saken ni Maico.

19. Microscopes have played a critical role in the development of modern medicine and scientific research.

20. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

21. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

22. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

23. Ang daddy ko ay masipag.

24. Psss. si Maico saka di na nagsalita.

25. Naglakad kami sa gubat na mayabong ng mga punong-kahoy, at naramdaman namin ang sariwang hangin.

26. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

27. Ang mga bayani ay nagturo sa mga kabataan ng mga aral at kahalagahan ng pagsisilbi sa bayan.

28. Mahirap magtiis kung mahal mo sya.

29. Mila Romero ang pangalan ng tiya ko.

30. Nagwalis ang kababaihan.

31. May sapot pa ng gagamba sa kanilang kisame.

32. Higupin natin ang gatas habang mainit pa.

33. Our relationship is going strong, and so far so good.

34. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

35. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

36. Magkano ang tiket papuntang Calamba?

37. You're not being direct. Stop beating around the bush and just say it.

38. Mahilig siyang kumuha ng litrato sa oras ng takipsilim.

39. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

40. Napatakbo ako sa kinalalagyan ng landline ng tumunog yun.

41. Si Mary ay masipag mag-aral.

42. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

43. Las vendas estériles se utilizan para cubrir y proteger las heridas.

44. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

45. Ang paglutas ng mga palaisipan ay hindi lamang tungkol sa pagpapakita ng kaalaman, kundi tungkol din sa pagpapakita ng kahusayan sa pagpapasya at paglutas ng mga suliranin.

46. Las plantas son seres vivos que realizan la fotosíntesis para obtener energía.

47. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

48. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

49. Proper training and socialization are essential for a well-behaved dog.

50. Nakatingin siya sa labas ng bintana, waring may hinihintay.

Similar Words

High-definitionhighest

Recent Searches

highkumakainmoodeksamkumidlathayoptendergapiikotpagsidlannamanworkshopsampungefficientnagdabogfalladesarrollaronnababalottakotfuncionarsinundoulot-ibangeditrollmanonoodcesbasahinbulapointpagkakamalipulubihawlamgareaderscinemakikitamananaloiyoventaaddressmakitakalakiseryosongnamabinabanagtungohiyasinimulaninstitucionessigurolibroamongnagbanggaanbulalassalbahenagtatrabahotusindvissaranggolamapakaliedsaalignsparadatapwatpalangakinmartialmaligayapagpapatuboheihimselfnagpakilalaxviimayabangnagkakakainmind:kabiyaknagyayangnapatigiltalagabooksvideos,katuwaandadalawinmataliknalalagaspebreroinfluenceskalaninaabotpadabogcomputermakakakaenmagnakawmesangbroadcastssanamananakawmakikitulogscalelegacymisteryojuanitomakikiraanbulsaseveralnawalanlumilingonkinahuhumalinganandykabighaipipilitcruzweddingmaghahatidsquatternakapagsabinagbasapumuntanag-poutcandidatenasabiinilistabumabaloti-rechargekakuwentuhanjoeunahiniginitgitnagreplyouteheheaumentarmakuhapinalutonabitawannakatitiyaknuevos10thkahaponkasinagpapaitimsecarsesamanagwo-workkumakapalipinauutangcarmenhalamanangniyonofrecenmagtiwalabakantemakulitpistaasincrossnagliliwanagtumabimag-ingatfundrisetalagangchoimabutipreviouslybetasiyudadbabeeveningsaritaonline,manatilituladorugaadmiredtindigsinikaplaruanlabing-siyammakawalaalexanderlalapitlolamatagallumakilumilipadhigh-definitionmakausapnapakamisteryosokaloobangpresidentialadvertisingipinamilinakuhapinangalanangsabongnoonmataaasngipinenvironment