Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

2. El trigo es uno de los cultivos más importantes a nivel mundial para la producción de harina.

3.

4. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

5. Patuloy pa rin ang paghalik ng butiki sa lupa tuwing dapit-hapon.

6. Esta comida está bien condimentada, tiene un buen nivel de picante.

7. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

8. Hindi ko alam kung bakit.. pero naiyak na lang ako.

9. Kahit na lilipad ang isip ko'y torete sa'yo.

10. Kinakabahan ako para sa board exam.

11. May bumisita umano sa bahay nila kagabi ngunit hindi nila nakita kung sino.

12. Ang bawa't isa ay may kanya-kanyang ginagawa.

13. Napakasipag ng aming presidente.

14. Disse inkluderer terapi, rådgivning og støttegrupper.

15. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng kaguluhan at kalituhan.

16. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

17. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

18. Have they made a decision yet?

19. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

20. Scissors should be kept sharp to ensure clean and precise cuts.

21. She's always creating drama over nothing - it's just a storm in a teacup.

22. Sinabi ng guro na huwag magtapon ng basura palayo sa tamang basurahan.

23. Ibinigay ng aking guro ang kanyang oras at dedikasyon upang masiguro ang aming matagumpay na pagkatuto.

24. Sa gitna ng gulo, pinili niyang mag-iwan ng mga taong hindi naaayon sa kanyang pangarap.

25. Isang matandang lalaki naman ang tumikim sa bunga.

26. Receiving good news can create a sense of euphoria that can last for hours.

27. Hindi dapat magpabaya sa pag-aaral upang makamit ang mga pangarap.

28. Nagpamasahe ako sa Boracay Spa.

29. Magandang araw, sana pwede ba kita makilala?

30. Kailan libre si Carol sa Sabado?

31. Hinde naman ako galit eh.

32. Luluwas ako sa Maynila sa Biyernes.

33. Ang daming limatik sa bundok na kanilang inakyat.

34. La película produjo una gran taquilla gracias a su reparto estelar.

35. Pigilan nyo ako. Sasapakin ko talaga 'tong isang 'to.

36. Siguro nga isa lang akong rebound.

37. Hudyat iyon ng pamamahinga.

38. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

39. Les patients hospitalisés doivent souvent rester alités pendant une période prolongée.

40. Hindi siya makabangon at makagawa ng gawaing bahay.

41. Nagdesisyon umano ang alkalde na ipagpaliban ang klase dahil sa masamang panahon.

42. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

43. Nationalism is often associated with symbols such as flags, anthems, and monuments.

44. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

45. Iinumin ko na sana ng biglang may umagaw.

46. Magkita tayo sa parking lot ng Luneta Park.

47. Palibhasa ay mahilig siyang magbasa, kaya marami siyang nalalaman sa iba't-ibang paksa.

48. Natanong mo na ba siya kung handa na siya?

49. Sana ay maabot ng langit ang iyong mga ngiti.

50. The exam is going well, and so far so good.

Similar Words

High-definitionhighest

Recent Searches

highimagingpinilingdividesexpectationscontinuesagilitypaslitsatisfactionlasingerolever,manlalakbaygamitinphilippinebahayhetohinimas-himaslorikatedralilawbruceipinaalamnagliliyablabaniniibigpagkakataonmalayanapakahangakaano-anobatiuusapankapitbahayinaabotgawinkumbentokaratulangpinipilitnag-uwikusinabankkalikasanpasoklaganapniyogsummitipinalutosyahiniritmerlindapinagalitannazarenogjorttinikhierbasmedisinabilhinflightbiropanunuksoatentobarung-barongnakakatawanalalaglagpaki-translatenagpapakaincultivoikinatatakotbalitaginhawanakatitignakalagayliv,manggagalinggagawinbefolkningen,fotosnamulaklaksikre,tumawagkapatawarankinapanayamkinasisindakanstrategiespansamantalabrancher,panalangintumagalyoutube,naiyaknagpagupitkabundukannakatulogmagtagomay-bahaymamahalinpatakbonanunuksokapintasangnaglokona-fundartistsabihinintramurospigilankinakainsukatinpinapakinggansumalakaysinehantulisan1970spinauwigarbansosmagsungitmakalingnakasakitmatulungintraditionalaustraliaduwendekirbypagongmatandangvitaminsasapakinkaraokeeroplanonagplaysagotnochekulisapkambingparoroonamanilasabog1960ssidoligalighumigakatolikodahilsilyanatulogtamadasalproducts:marangyangtulangpamamahingapinalayasmasipagnararapatfeelingindividualsbansangpakealamaumentarprutaskagandadumaanpasigawalamidkumukulopatunayanmaidmagigitingjosetilllaryngitisyepdapatclientsramdamsemillaskatandaanparoiatfbotantehumalikproveimportantesseeabonocardfraoliviaklimaformasmagdacompostelahangaringhelenajunjuntablepersistent,stuffedinterviewingsimplenginterpretingfly