Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. His speech emphasized the importance of being charitable in thought and action.

2. Nogle helte er kendte for deres modige handlinger under krig.

3. A veces es difícil encontrar buenos amigos, pero cuando los encontramos, vale la pena.

4. The bakery specializes in creating custom-designed cakes for special occasions.

5. Maghanap tayo ng mga kabibi sa tabing-dagat.

6. Kagyat na bumaha ang nakaliliyong dilim sa kanyang utak.

7. Walang matimtimang birhen sa matiyagang manalangin.

8. Suot mo yan para sa party mamaya.

9. La lluvia produjo un aumento en el caudal del río que inundó la ciudad.

10. Ang pagdidilim ng kalangitan ay nagpakalma sa init ng araw at nagbigay daan sa isang magandang sunset.

11. Menciptakan keseimbangan antara pekerjaan, waktu luang, dan hubungan sosial membantu meningkatkan kebahagiaan.

12. Sa bawat tunog ng kundiman, nararamdaman ang lambing at sakit ng pusong umiibig.

13. Red horse? Ikaw? nagtatakang tanong ni Genna.

14. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

15. Más vale prevenir que lamentar.

16. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

17. At blive kvinde kan også være en tid med forvirring og usikkerhed.

18. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

19. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

20. Hindi. Ipinangangak ako sa Cebu.

21. Kailangan ko ng pliers, puwede ko bang hiramin ang iyong tools?

22. A lot of people volunteer their time and resources to help those in need.

23. Paki-translate ito sa English.

24. Einstein's writings on politics and social justice have also had a lasting impact on many people.

25. Wala akong pakelam. Respect nyo mukha nyo.

26. Agama juga sering menjadi landasan bagi hukum dan kebijakan di Indonesia, dengan prinsip-prinsip agama tertentu tercermin dalam sistem hukum negara.

27. Kumain na ako pero gutom pa rin ako.

28. Ang Chinese New Year ay isa sa pinakamahalagang pagdiriwang sa kultura ng Tsina.

29. Maglalaro ako ng tennis. Ikaw?

30. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

31. Laganap ang paggamit ng social media sa kabataan ngayon.

32. Napakaganda ng disenyo ng kubyertos sa restaurant na ito.

33. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

34. Nagbalik siya sa batalan.

35. Lights the traveler in the dark.

36. Pakiluto mo nga ng pancit ang mga bata.

37. Ang sabi nya inaantay nya daw girlfriend nya! Ang sweet!

38. El nacimiento puede ser un momento de alegría y emoción para la familia, pero también puede ser estresante y desafiante.

39. Kailangan magpakatotoo at humingi ng tulong kung hindi makakabayad ng utang sa tamang panahon.

40. Da Vinci tenía una gran curiosidad por la naturaleza y la ciencia.

41. Malapit ang pook na ito sa bundok ng Rabba.

42. Håbet om at opnå noget kan motivere os til at tage skridt for at nå vores mål.

43. Lakad pagong ang prusisyon.

44. Beauty ito na oh. nakangiting sabi niya.

45. They are running a marathon.

46. Shaquille O'Neal was a dominant center known for his size and strength.

47. Ang nakapagngangalit, unti-unti na namang nalalagas ang kaniyang buhok.

48. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

49. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

50. Sa takip-silim, nagiging malamig ang panahon at nakakapagbigay ng komporta sa mga tao.

Similar Words

High-definitionhighest

Recent Searches

ceshighsheconsiderartipidkumatoknitosolidifythreeulomitigatemanagerlasinggalitrequirepeksmanprogrammingtrinasumasayawkaninumankabiyakkesotibokmakasalanangpagsidlanberegningertilgangpagtutolpumiliiniuwibulaklakpinagawapadalassalbahengundasginawangisinuottaga-nayonkuwartonagsusulatpaidpagbebentaunattendedmedikalbandatigasnangingisaykalalakihanmadamilumilingonstaymagtiwalanakaka-inpagngitihahahapumatolleodiwatangtungkodnatakotbaranggayvaccinesjerrymabatongnakabaonpagtataasconvertingipagmalaakilalongkasipaldacarolkumarimotpaksapadabogprincesaranaglalabanatitirapinagkaloobanyaribinawiprimermalakingpagsasalitavirksomheder,pagkakapagsalitanakakabangonpatutunguhanmagkakagustonakakapasokpagpasensyahanmumuntingmakasilongcruciallabing-siyampagkabuhaydumagundongiwananipongarbejdsstyrkemagalangnananalonggumawanapakalusogpaghaharutanaplicacionesestasyonalapaapmagsunogmaanghangpartsmagtakamabutingginawaranbalediktoryannagpalutonangangakolumamangnagsmilepamasaheonline,kadalasisinagotgiyerapagbigyantinataluntonnagwelgainaabotfuenagisingmagsungitmaabutanpaninigaspagonggagamitnabigkastawanannagbibigayanlansangantelecomunicacionesginagawadelepromiseitinaasdalawamarinigabanganparkepalitanincrediblengipingsesamepaskoentertainmentmalilimutantasapinisilkababalaghangconclusion,rimasbahagyangtakotnaawafederalkatagatilimatabangmeronmakatipangalanannagniningningmaaksidenteexpeditednasuklamtandaenglandnicomatulismakakawawanakacombinedmatigassaykumapitarabiabilugangpeacewaripaskongcelularesgayunpamannuhbritishmalambingencompassesfacepsssproudphilippine