Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Durante las vacaciones, disfruto de largos paseos por la naturaleza.

2. The Grand Canyon is a breathtaking wonder of nature in the United States.

3. Dahil sa pagmamahalan ng dalawang pamilya, ang pamamamanhikan ay naging isang masayang pagtitipon.

4. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

5. Masama pa ba ang pakiramdam mo?

6. Napagod si Clara sa bakasyon niya.

7. They walk to the park every day.

8. May problema ba? nagtatakang tanong ni Maico.

9. This is my girl, Jacky. pagpapakilala ni Maico sa akin.

10. Ano ang gustong sukatin ni Andy?

11. Ang bilis nya natapos maligo.

12. Paano ka nakapasok sa bahay kagabi?

13. Baka sakaling magbago si Aya kung ito ay isa na ring ina.

14. Isang mahahalagang pag-uusap o tagpo ang naganap sa loob ng kabanata, na nagbibigay ng bagong pag-unawa sa mga karakter.

15. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

16. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

17. Dapat nating igalang ang kababawan ng bawat tao dahil hindi natin alam ang kanilang pinagdadaanan.

18. Hindi pa namin napapag-usapan eh. sagot niya.

19. Napahinto siya sa pag lalakad tapos lumingon sa akin.

20. Masarap ang bawal.

21. Practice makes perfect.

22. Gusto po ba ninyong lumipat sa ibang kuwarto?

23. He set up a charitable trust to support young entrepreneurs.

24. The fashion designer showcased a series of collections, each with its own unique theme and style.

25. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

26. Está claro que el equipo necesita mejorar su desempeño.

27. But television combined visual images with sound.

28. Sa panahon ng krisis, mahalagang magtulungan tayong lahat, datapapwat ay may mga taong hindi nakakaintindi ng kahalagahan nito.

29. La creatividad se puede aplicar en cualquier campo de trabajo.

30. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

31. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

32. Maliksi siyang lumapit at binatak ang bata sa liig.

33. Ano ang ipinabalik mo sa waiter?

34. mga yun. Ang mahalaga ay makapagempake ako agad.

35. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

36. Halos lahat ng mga misa sa aming parokya ay may awiting Bukas Palad.

37. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

38. Ada berbagai jenis kucing yang ada di Indonesia, seperti kucing Persia, Siamese, dan Scottish Fold.

39. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

40. Sa buwan ng Mayo ang kaarawan ko.

41. They launched the project despite knowing how risky it was due to time constraints.

42. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

43. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

44. The information might be outdated, so take it with a grain of salt and check for more recent sources.

45. Las labradoras son muy activas y necesitan mucho ejercicio diario.

46. Hinayaan kong lumabas ang malalim na himutok upang ipahayag ang aking galit.

47. Las labradoras son conocidas por su energía y su amor por el agua.

48. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

49. Sa bawat tagumpay, dapat nating ipagdiwang ang bawat pagsisikap na ginawa natin, datapapwat ay hindi naman ito palaging madaling maabot.

50. Kumain ako ng itlog kaninang umaga.

Similar Words

High-definitionhighest

Recent Searches

alaalasasamahanstudentshighginawaranherundercharitablehuwebesrightspagkaimpaktoalbularyounangibinibigayambagmalapitanpitumpongvedglobalisasyonreaksiyon2001pingganpasanpamanhikansiksikantiemposmabihisantraditionalfilipinanapalitangchildrenmariagreenfreelancernagtataaslacktuluyangfidelbroadcastingkinalilibinganconvey,judicialpahabolkawili-wilinayonaniharapanlumiitsalaminscientificnagsagawamaayosiikutanbihirapagpapatubokongresogivermagbabalalendingnawalangnanayrespektivemagbagong-anyonapakahusaynaglalakadmaramotmagbalikkristolansanganhinilamayroonnagmakaawamaluwanginuulambuslobabaedaangfansnakaluhodpressmatesaarbejdsstyrkenaiiritangasiagayunpamanlot,anumandiyosabiyahepaghingidespuesgawinorastablenag-aalanganateresumenparusahanwalnggananapabayaanmurangbumangonawitanmurang-murakatedralmagbibiladnakaangatkatawannaglaonmakuhangmisyunerongperfectnatagalanbinanggagulofranciscopaglingonenglishfar-reachingsinkstillartistsgodmanamis-namiswealthandynasunogpangingimiaywanmatindingkinakailanganrobertnapatinginnapakagandapagbabayadochandonapakagagandanag-iisangpetsabroughtkargahanalayhukaypapagalitanluboslumuwaszooallowedcandidatenawalapagkatakoteksaytedpumulotburdenpumuntanatingalatabingpangungutyawritesequemakilingamendmentsbrancheseasynyastyrernapapatinginjoemasaksihanwebsitepangkatnapilingkinissmakainrestaurantdecreasedkakainhusoinilagaymainitstudiedknowledgebulalassocialeenglandelijegalitrenombrelender,maghintaykinabubuhaykinainnatuloypantalonlinggongmangkukulamhiwagapinagkakaabalahanaddictiondyip