Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

2. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

3. I complimented the pretty lady on her dress and she smiled at me.

4. Nang matanggap ko ang taos-pusong paghingi ng tawad, ang aking galit ay napawi at nagkaroon kami ng pagkakasunduan.

5. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

6. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

7. Agad niya itong kinuha at isinaboy sa paligid ng salamangkera.

8. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

9. Nous avons choisi une chanson spéciale pour notre première danse.

10. Palibhasa ay mahusay sa pagbasa ng mga komplikadong mga aklat at materyales.

11. Sa isang malayong pook sa Pilipinas nakatira ang mag-asawang sina Mang Kandoy at Aling Pising.

12. Ibinigay ng mga magulang ko ang lahat ng kanilang sakripisyo upang maibigay ang magandang buhay sa amin.

13. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

14. Sinabihan siya ng magulang na huwag maging maramot sa kanyang mga kapatid.

15. may butil na rin ng pawis sa kanyang ilong.

16. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

17. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

18. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

19. Mababa ang antas ng tubig sa dam, kaya nagpatupad ng water rationing.

20. Det er vigtigt at have et godt støttenetværk, når man bliver kvinde.

21. Gusto ko lumabas pero malakas pa ang ulan.

22. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

23. Kapag hindi tama ang timpla ng pulotgata, maaaring maging mapakla o mapait ito.

24. Bakit ba gusto mo akong maging bestfriend?!

25. Ngunit marumi sila sa kanilang kapaligiran.

26. Bigla siyang bumaligtad.

27. Ang mailap na impormasyon ay kailangan pag-aralan ng mabuti upang maiwasan ang pagkakamali.

28. Inisip niya kung ano ang kasuutan nito na maaari niyang pagkakilanlan, ang tabas ng mukha, ang gupit, ang tindig.

29. Binulabog ng malakas na tunog ang katahimikan ng paligid.

30. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

31. Ang mailap na kaligayahan ay kailangan hanapin ng mabuti.

32. Okay.. sige.. intyain ko na lang tawag niya.. thanks..

33. Guten Abend! - Good evening!

34. El maíz necesita sol y un suelo rico en nutrientes

35. Hinde ko alam kung bakit.

36. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

37. Mahal na mahal ng ama't ina si Ranay.

38. May nagbigay sa amin ng biglaang free food sa opisina kanina.

39. Ilan ang tiya mo na nasa Amerika?

40. Bawat pamilya ay may magarang tarangkahan sa kanilang mga tahanan.

41. Bumili si Ana ng regalo para diyan.

42. Napahinto rin kami dahil kay Jenny.

43. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

44. Makikita ko si Mrs. Santos bukas.

45. Ang mga pabango sa tindahan ay nag-aalok ng iba't ibang mga amoy, mula sa mabango hanggang sa matapang.

46. Waring may nais siyang sabihin, ngunit pinili niyang manahimik.

47. El nacimiento de un bebé es un recordatorio de la belleza de la vida.

48. Las hierbas silvestres crecen de forma natural en el campo y se pueden utilizar en infusiones.

49. Natandaan niya ang mga panunuksong iyon.

50. Ang pagpapalakas ng aking katawan sa pamamagitan ng ehersisyo ay nagbibigay sa akin ng isang matiwasay na pisikal na kondisyon.

Similar Words

High-definitionhighest

Recent Searches

highbaranggaylanamangangahoymamitasbalinganshareconsiderbulanahihiyangdecreasesignquicklyregularmentesatisfactionalas-dosnagulatkapitbahaymahigitpaskongganitoguhitetsypatakbopioneeramingkonsiyertoalakpagputibalediktoryanduwendemuntingremotegeneratedmonetizingeducativasnapaplastikandiyabetisnangyarigagawinkatolisismohapdidedicationcrazymabatongseetumulonglever,ofteipagmalaakiiiwasanmakikipaglarosakalingpopularnagnakawdahan-dahannapakatibokinformationidaraangigisingmindpauwihoyinfinitynapatinginsandokinabutankahitbinilhanorasnanunuksorobertsambitpodcasts,sakayparaangkulotgodtabeneharitabingmanlalakbaymalakingmagbibigaykaliwangjunjunstagemagdilimmanatilikaninamakalingallowedrangematigasseekpagsagotnapalakassapagkatnamumulaklakeffortslittlediedmagalangbiglaanipantalopdiyosamensahenakakainsasapakinmanunulatpagdamithereforecompositorespinakamatapatchesstig-bebeintelavestatewhichmaipapamanalucaspossiblenagpabayadparipanimbangnakikihalubiloinaabutanunattendedulitugalimagulangtuloynangampanyatilaraymondrawrailbinibiyayaanpupuntarichpreviouslypinadalaperpektopatutunguhanpasensyapaperpakialamnanlilisikpagtinginoponilulonnazarenonasawinasasabihannangyaringhotdognabasamontrealsocialemobilemiraminatamismatatagmatanggapmakinangmahinogluisaleadingmovinglamesalamankinayasisidlankinasisindakansiyakatagalshowskalayuannakainomkailannasundoislatopicipagbiliprotegidohiramin,hinukaybaguioformamalapalasyoediteconomyecijadrinksdidcurtainscuriouscreditcanada