Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Wala akong pakelam! Dapat sayo pinapalo!

2. Ano ang kinakain niya sa tanghalian?

3. Noong una, sinasagot niya ang mga panunuksong ito.

4. Mga prutas ang tinitinda ng tindera.

5. Nagising ako sa marahang pagtayo ni Maico.

6. Mahal ang mga bilihin sa Japan.

7. Si Emilio Aguinaldo ang pinakamatandang nabuhay na pangulo ng Pilipinas, na namatay sa edad na 94.

8. Algunas serpientes son capaces de desplazarse en el agua, mientras que otras son terrestres o arbóreas.

9. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

10. Mabuti na lang at hindi ako nauntog sa bubong ng dyip.

11. Nakahug lang siya sa akin, I can feel him..

12. El maíz es un cultivo exigente en nutrientes, por lo que es necesario aplicar abono regularmente

13. Doa dapat dilakukan dalam bahasa apapun, asalkan dipahami oleh orang yang melakukan doa.

14. Making large purchases without consulting your budget is a risky move.

15. Huwag kang gagamit ng illegal na droga.

16. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

17. He teaches English at a school.

18. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

19. Anong oras mo gustong umalis ng bahay?

20. Las rosas rojas son un regalo clásico para el Día de los Enamorados.

21. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

22. Better safe than sorry.

23. Keep in mind that making money online takes time, effort, and patience

24. Maraming uri ng mga punong-kahoy na maaaring gamitin sa paggawa ng mga gamit tulad ng upuan, mesa, at iba pa.

25. Leonardo da Vinci nació en Italia en el año 1452.

26. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

27. Matapos ang isang mahirap na araw, nagpalabas ako ng malalim na himutok para maibsan ang aking pagod.

28. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

29. Les patients sont souvent admis à l'hôpital pour recevoir des soins médicaux.

30. Tara na. binuksan ko yung pinyuan tapos lumabas kami.

31. She does not procrastinate her work.

32. Después de hacer ejercicio, me gusta darme una ducha caliente.

33. El deportista produjo un gran esfuerzo para ganar la competencia.

34. Lumibot sila sa kagubatan upang masulyap ang kagandahan ng kalikasan.

35. Ang mga manggagawa at magsasaka ay kabilang sa sektor ng anak-pawis.

36. Pinag-iingat ng mga awtoridad ang mga mamamayan laban sa mga salarin na gumagala sa paligid.

37. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

38. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

39. Kung walang tiyaga, walang nilaga.

40. Kinuha naman nya yung isang bote dun sa lamesa kaso.

41. I always feel grateful for another year of life on my birthday.

42. Ang hirap pigilan ng inis kapag may nagawa sa atin ng hindi maganda.

43. Nagtatanong ako sa kanya kung ano ang mga gusto niya upang masiguro na magugustuhan niya ang aking mga regalo.

44. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

45. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

46. Ang mga tao na gumagamit ng droga ay maaaring tumanggap ng tulong sa mga rehab center upang magbago ang kanilang buhay.

47. An omelette is a dish made from beaten eggs cooked in a pan.

48. Gusto. pag-amin ko kasi gutom na gutom na talaga ako.

49. Uanset ens religiøse overbevisning er påsken en tid til at fejre håbet om nyt liv og genfødsel.

50. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

Similar Words

High-definitionhighest

Recent Searches

highespadasusulitkungenfermedadestatagalsasamahankakayurinhomemaramingkuligligroomkapilinghesuskinalakihanwonderintramurostugondefinitivojemibangkapangingimiumarawcryptocurrency:culpritpromotingresearchmagsusuotinaliscaraballomapangasawaflyfistsparticipatingfuetwobarongwaitkasiyahanbandasirkinauupuangparkeothershacerhistorycivilizationconditioningmanahimikmasayang-masayangyouthnakakatakotpamumuhaykonsultasyonnagpalipatloveuniqueo-orderipinalutonagliwanagbingoshowculturesguestsmovinghardtaleconstantlyxviieyepinagsulatsilayngayongnagpa-photocopykrusdreamspagkaingmagkakailaballgracebulaklakpingganika-50nakudispositivosstudentcadenamadeothernunoparaibat-ibangmahinashapingevolvehumblesamakatwidkakutistenermagandang-magandapananakotperoyataorasanpamamasyaloutinformedwouldconcernsabut-abotpangalannasasakupangenechangedfirstlorynagnakawmagpaniwalasmiledamitproductiondustpanmarmaingcommunitygathernatingalanapakabagalpunonangeachrichpagbabasehanmakelolomacadamiajohnheartbreaknagmistulangdontinalalayanandlegendarynegativedejanapapangakohabangnakainomlibretakefutureneedallnagpanggapfriendkalabawconservatoriosnanghihinaakinsomethingbackpinalambottagalognagwo-workmatatalinoikawhinanappaanoganangredigeringnapakabilistracksigurosumpainpinagmamasdandomingipinamilisistemasgayundinsakopworkpumulotemnerplatformsbigyankarangalansinakopdurianandreoperativosincreasesconsiderfalllinedrinkskasalukuyanmakagawalutuinnagpuntahanmagdala