Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

2. They have already finished their dinner.

3. Pede bang itanong kung anong oras na?

4. The little girl dressed up as a pretty lady for Halloween.

5. Doa dapat dilakukan dalam bahasa apapun, asalkan dipahami oleh orang yang melakukan doa.

6. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

7. El cambio de gobierno produjo una reorganización completa de las instituciones.

8. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

9. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

10. Børns mentale sundhed er lige så vigtig som deres fysiske sundhed.

11. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

12. En el siglo XIX, el Romanticismo español tuvo un gran impacto en la música, con compositores como Isaac Albéniz y Manuel de Falla

13. I found a great recipe on a cooking website that I can't wait to try.

14. Hockey is played with two teams of six players each, with one player designated as the goaltender.

15. Kebahagiaan adalah keadaan emosional yang diinginkan oleh setiap orang.

16. Maraming daga ang nahuli ng pusa ni Leah.

17. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

18. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

19. Hindi matatawaran ang hinagpis ng mga magulang na nawalan ng kanilang anak sa digmaan.

20. Ang hirap pigilan ng inis kapag may nagawa sa atin ng hindi maganda.

21. Sa bawat tunog ng kundiman, nararamdaman ang lambing at sakit ng pusong umiibig.

22. Risk tolerance is an important factor to consider when deciding how to invest.

23. Ilang tao ang nahulugan ng bato?

24.

25. Would you like a slice of cake?

26. Sa tahanan, ako'y nakatulog nang matiwasay sa aking malambot na kama.

27. Ang sabi naman ni Bereti ay naiinggit kay Karing dahil marami itong bagay na nararanasan na hindi niya nararanasan.

28. The singer's performance was so good that it left the audience feeling euphoric.

29. Makabalik na nga sa klase! inis na sabi ko.

30. Hiram na libro ang ginamit ko para sa aking research paper.

31. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

32. Dumating na sila galing sa Australia.

33. Ikinalulungkot ko ang balitang yan.

34. Makikita ko ang mga kapatid ko sa pasko.

35. Sumakay ka sa harap ng Faculty Center.

36. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

37. Nagmumukha siyang Intsik-beho kapag suot iyon ngunit wala naman siyang maraming kamisetang maisusuot.

38. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

39. Ano ang suot ng mga estudyante?

40.

41. Ang korupsiyon ay laganap sa gobyerno.

42. Dahil sa aksidente sa pagpapatakbo ng negosyo, nagsara ang kumpanya at maraming tao ang nawalan ng trabaho.

43. ¿Quieres algo de comer?

44. Ang pangalan niya ay Ipong.

45. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

46. Ang bayanihan ay nagpapakita ng diwa ng pagmamalasakit at pagbibigayan sa aming komunidad.

47. Ang paggamit ng droga ay hindi lamang nakakasira ng kalusugan ng isang tao, kundi maaari rin itong magdulot ng epekto sa buong lipunan.

48. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

49. The culprit responsible for the car accident was found to be driving under the influence.

50. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

Similar Words

High-definitionhighest

Recent Searches

lalabhanmabalikhighfuncionesmodernpollutionbroadcastsgitnadarksquatterpakitimplajoysagingmentalsinaliksikmakenangagsipagkantahannaglipanangnaglalarokagalakansasagutinhellokondisyonkisstaglagasperyahankabiyaknakangisinggovernorssusunodpag-aaniwantmarangalpaglayasnakabiladpagpasokpa-dayagonalsalatinpaggawatresmalapitanroselleginawangloanslatedayspedenginteligentessetsrepresentativecountlessworkcleanawang-awaumiinompaki-drawingmahuhusaypangungutyakinikitamanahimikmahinapaghanganalagutanngayoniiwasanumiibigpaanonatutuwabalikattmicapinatawadpnilitiyonghinampasbutitomorrowsadyangkasocapacidadcarriesaaisshfiabeganopomahahabahanbobosaringetotrainingpinunitoftemalezanapatawagfotoshampaslupatumawagpagtawastrategieskaklasewatawatpopulationstyleculturekampeonpicturespagongpantalonkinseligaligpadalastalagangknightsabogkulisapbotantekruschoiipagamotmenossystematisksamameetcafeteriacasesawarekikitanakapagreklamonagtuturonahawakanlagingsakristanpangungusapmatapobrengbutikikanlurannaglokohanpinipilitautomatisknaliligohinilanakapikitlalokumantadiretsahanglaganapisipankapaladecuadosisipainrepublicangraphicnataposandrestuwangdulothehesaanmatchingreservesveryadvancedkararatingguardadibisyongenerationsiosdonikinakagaliterhvervslivetmagagawamagturokinalakihancualquiernaminlinawkayabevaresigeleyteplaceipagbilidatitenbelievedpangambadinilockdowncancerandreformacertainaanhinmoviesnagtakanagpabayadtatagalnakakainhimihiyawkagipitan