Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

2. Dumating ang bus mula sa probinsya sa hatinggabi.

3. Dahan-dahang pumapatak ang gabi at unti-unting nagdidilim ang mga kalye sa paligid.

4. Kumain ako ng itlog kaninang umaga.

5. Isang araw, isang matanda ang nagpunta sa bahay ng bata at hinamon niya ito.

6. Ang pagtulong sa iba o pagbibigay ng serbisyo ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

7. Gusto ko sanang makabili ng bahay.

8. She has been preparing for the exam for weeks.

9. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

10. Bumili kami ng isang mapa ng kalakhang Maynila para mas magaan ang pag-navigate sa lungsod.

11. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

12. Some couples choose to have a destination wedding in a different country or location.

13. Naulinigan ng makapangyarihang Ada himutok ng Buto.

14. Uncertainty can create opportunities for growth and development.

15. Ang aming koponan ay pinagsisikapan na makuha ang kampeonato sa darating na liga.

16. Nagtatrabaho ako tuwing Martes.

17. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

18. The policeman directed the flow of traffic during the parade.

19. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

20. La tos puede ser tratada con terapia respiratoria, como ejercicios de respiración y entrenamiento muscular.

21. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

22. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

23. They do yoga in the park.

24. Huwag mong hiramin ang aking payong dahil umuulan pa rin.

25. Maruming babae ang kanyang ina.

26. "Dogs are not our whole life, but they make our lives whole."

27. Napakaseloso mo naman.

28. Kanina sabi mo joke, ngayon example. Ano ba talaga?!

29. Kumakain ng tanghalian sa restawran

30. Ang mga magsasaka sa kanayunan ay nag-aapuhap ng suporta mula sa gobyerno para sa kanilang mga pananim.

31. Sa mga huling taon, yumabong ang turismo sa lugar na ito dahil sa mga magagandang tanawin.

32. Det er også værd at bemærke, at teknologi har haft en stor indvirkning på vores samfund og kultur

33. If you did not twinkle so.

34. Ang tindera ay nagsusulat ng mga listahan ng mga produkto na dapat bilhin ng mga customer.

35. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

36. Kukuha na ako ng lisensya upang makapagmaneho na ako.

37. Matapos mabasag ang aking paboritong gamit, hindi ko napigilang maglabas ng malalim na himutok.

38. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

39. Palibhasa ay mahilig siyang magbasa, kaya marami siyang nalalaman sa iba't-ibang paksa.

40. Napadungaw siya sa bintana upang tingnan ang magandang tanawin.

41. Hindi na niya narinig iyon.

42. Ibinigay ko ang aking tulong sa mga naghihirap upang masiguro ang kanilang kaligtasan.

43. Smoking-related illnesses can have a significant impact on families and caregivers, who may also experience financial and emotional stress.

44. Kung anu ano ang kanilang pinag-usapan hanggang sa bigla na lang napabalikwas ang prinsipe na tila ba may tumawag sa kanya.

45. Kukuha lang ako ng first aid kit para jan sa sugat mo.

46. Hindi siya nakapagpahinga ng maayos kagabi, samakatuwid, inaantok siya ngayon sa klase.

47. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

48. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

49. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

50. Les salles d'hôpital sont souvent partagées entre plusieurs patients.

Similar Words

High-definitionhighest

Recent Searches

downhighpopulationipinagainkarapatankumakainairplanesnapahintovictoriakinaiinisaniniwanpasensiyayarimakatibakacapitalsusundomarasiganmaarisongimportantekatandaannakainbahaytarangkahanarghinspirasyonipinakosamagusting-gustoletrelevanttagaytaypromotinginterestvedvarendesalitangbagongnakaakyatnaibabaricoelectganitoshiftalituntuninhumigakungnag-aagawanatensyongintensidadnegosyantepointlinemabangokainanasahanmunahinabolipagpalitsalitamobilemakisuyoinfectiousanywhereiintayindistanciamabaitcoachingbasatapatsaringkatagangjokehistaonparanglumilipadpinangalanangmataaasbilanginsabonggustongunanpagsayadhoneymoonagam-agamlalalaromasipagmaibaliksubalitpaungolsumunodnoonadopteddesdedependingsaan-saannamumuopapuntangnoongnagbabakasyonsubjectbehindpinatutunayanduonadaptabilitypanalanginzoomnamasyalisinaradunkinagatkasobuksanpedepamilihanisagayundinnamungasinobiggestuniquebanalbandangseryosopanggatongginoomahinahongibabakalngunitpagkalungkotnegro-slaveswebsitekalalaropaglalabanancorrectingnatuloytilskrivesbaclarangreatlymagsunogtaposinisiplumalaonlalargakapangyahiranbahagingdamdamindomingointernalnanatilirebolusyonnamannakakatulongbluesninongitimnagingengkantadatumangonamumulotsutilmasayahinnababalotclarapagkaimpaktobumisitanatuyomalulungkotmagsaingkamalayansagasaanaraw-arawnaguguluhangalmusalintelligencekaragatanmaestrakaniyaturismotillseryosongtiempos2001bluepundidokuligligvideoslabantilnaglahobakurancreatesunud-sunodeksport,nakagawiancultura