Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

2. There are a lot of opportunities to learn and grow in life.

3. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

4. Napahinto siya sa pag lalakad tapos lumingon sa akin.

5. When we forgive, we open ourselves up to the possibility of reconciliation and rebuilding damaged relationships.

6. Scientific evidence suggests that global temperatures are rising due to human activity.

7. Has she read the book already?

8. Tumayo tayo para awitin ang Pambansang Awit.

9. Ang puno ng mangga sa bakuran namin ay hitik sa malalaking bunga ngayong tag-init.

10. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

11. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

12. Maarte siya sa mga lugar na pupuntahan kaya hindi siya nakikipagsiksikan sa mga madaming tao.

13. Sa tuwa ng Elepante ay kumembut-kembot ito sa pag-indak.

14. Sayur asem adalah sup sayuran dengan bumbu yang asam dan pedas.

15. The momentum of the train caused it to derail when it hit a curve too quickly.

16. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

17. Nakangiting tumango ako sa kanya.

18. The charitable donation made it possible to build a new library in the village.

19. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

20. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

21. Musk is the CEO of SpaceX, Tesla, Neuralink, and The Boring Company.

22. Halatang takot na takot na sya.

23. Lapat na lapat sa kanya ang kamisetang iyon noong bagong bili ngunit ngayo'y maluwag na.

24. Ibinigay niya ang kanyang pera para matugunan ang mga pangangailangan ng komunidad.

25. Viruses can spread from person to person through direct contact, airborne transmission, or contaminated surfaces.

26. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

27. Sa dapit-hapon, masarap mag-stroll sa mga kalye at maghanap ng masarap na kainan.

28. Maraming paaralan at kalsada ang binigyan ng pangalan ni Mabini sa buong bansa.

29. Kailangan na nya makuha ang resulta ng medical exam bukas.

30. Nosotros disfrutamos de comidas tradicionales como el pavo en Acción de Gracias durante las vacaciones.

31. Napatingin ako sa kanya, Bakit naman?

32. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

33. Kadarating mo pa lamang, Ogor, nais niyang itutol.

34. Napakabagal ng internet sa aming lugar.

35. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

36. Inakalang mahal siya ng kasintahan, pero hindi pala.

37. Nakagagamot ng diyabetis ang halamang ito.

38. Det danske økonomisystem er kendt for sin høje grad af velstand og velfærd

39. Tinuruan niya ang kanyang anak na maging magalang sa mga nakatatanda.

40. I am exercising at the gym.

41. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

42. Huwag kang maniwala dyan.

43. "Every dog has its day."

44. Pagkatapos ng ulan, naging maaliwalas ang kapaligiran.

45. Tinanggal ko na yung maskara ko at kinausap sya.

46. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

47. Si Doming na nagkaroon ng kasintahan na maganda ay inagaw ng kanyang kaibigan

48. Gusto ko na talaga mamasyal sa Singapore.

49. Waring hindi pa handa ang kanyang puso na magmahal muli.

50. Gaano katagal ho kung maglalakad ako?

Similar Words

High-definitionhighest

Recent Searches

dollardoonconnectionschoolhighimagingfascinatingtumindigmethodsaffectwhileandroidilingpasinghalbitbitrequireevolvecallingpersistent,menuanotherfrogseparationbroadcastingnakakatandapagdudugomakabiliconnectingbagalfriendmulighedginugunitaibabawpalancamaipagmamalakingcultivarkalyefitnessmanoodpinakidalanamatayanyosumalimagalangnakataaspawiinmasyadongmanahimiktabingnanalonanunuriumiimikpalibhasakapatawaranpaboritonginuulampoongfysik,pagkagracepaidhinihintayvaccinescosechar,sementongpaoshudyattamadbobotopa-dayagonalsalessellingnagtitindapinakamagalingmakapangyarihankinakitaannapakahangagobernadornakikini-kinitamensajesmakapagsabisakristanbefolkningen,inakalangpagkabuhaymahahanaynagsagawanakalagaynagpipiknikpagpasensyahanmanggagalingkatawangpalabuy-laboykuwartoipapautangkaninumankulungansalbahengmalapalasyosumusulatpresidentepagkaangatmahahalikmahiwagakapamilyanagreklamonagpakunotpagkagustonakapasokyumabonguniversitykagubatanmagdamagpakakasalanpagbebentahulihancardigannapakabilislumutangnagpalutosiksikanstoryumiyakitinatapatginawangpamagatmaliniskolehiyosamantalangmalalakimatumalginagawasilid-aralankastilanghagdananisusuotbangkangnglalabaproduceiniuwiperyahancruzkirbysandwichhinilapinapakingganpagongkuligligmasayainiresetasukatinsumalakayliligawan1970snaguusapkasayawtienenmagisipmapaikotganidbagkussumisidlalakehotelpangkatbuhokpinalayasparehasiniisiphelpednararapatangelamatayogkailannasahandaanenglandlangkaykumustasisipainperwisyomariegustongumagabarongkatolikomatandangbarcelonacommercialincredibleinspirationnabigaykaugnayansumingitcolormatabangayawstocksbinanggamatigas