Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Duon nakatira ang isang matandang babae at ang kanyang apo, isang binatilyo.

2. Dahil sa kanyang pagka-suway, si Carla ay napag-initan ng kapwa niya empleyado.

3. Nanghahapdi at waring nasusunog ang kanyang balat.

4. Gusto ko sanang makabili ng bahay.

5. Saan ako nag-aaral ng kindergarten?

6. Hindi dapat natin ipagkait ang mga oportunidad na dumadating sa atin, datapapwat ay hindi ito madaling makamit.

7. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

8. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

9. Isang araw nagkasakit si Aling Rosa.

10. Ang tag-ulan ay isa sa mga panahon ng taon na nagdadala ng malakas na pag-ulan at kadalasang nagdudulot ng baha at landslides.

11. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

12. Ang aming pamilya ay nagpapahalaga sa konsepto ng bayanihan at palaging handang tumulong sa kapwa.

13. Walang tigil sa paghalakhak ang matanda mula sa kanyang kinatatayuan.

14. Ang biograpo ay nagsusulat ng mga kwento ng buhay ng mga kilalang personalidad.

15. Ang pagdadasal ng rosaryo tuwing alas-sais ng gabi ay isang ritwal na hindi nila kinalilimutan.

16. Det kan være en udfordrende tid at blive voksen og kvinde.

17. Kucing dapat dilatih untuk melakukan beberapa trik seperti menjulurkan tangan untuk berjabat tangan atau melompat melalui ring.

18. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

19. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

20. Para sa akin ang pantalong ito.

21. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

22. Medarbejdere kan arbejde i forskellige områder som finans, teknologi, uddannelse, etc.

23. Yumabong ang pagmamahal ng mga tao sa mga hayop dahil sa mga kampanya para sa kaligtasan ng mga endangered species.

24. Nagulat ang magkasintahan nang biglang dumating ang pamilya ng lalaki para sa pamamamanhikan.

25. Ang Ibong Adarna ay may mahabang kwento na puno ng kaguluhan at kababalaghan.

26. L'auto-évaluation régulière et la mise à jour de ses objectifs peuvent également aider à maintenir une motivation constante.

27. I used my credit card to purchase the new laptop.

28. Sa hirap ng buhay, ang aking kabiyak ay ang aking kakampi at kasama sa pagtahak ng mga hamon.

29. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

30. At siya ang napagtuunan ng sarisaring panunukso.

31. Mathematics has a long history and has contributed to many important discoveries and inventions.

32. Promise yan ha? naramdaman ko yung pag tango niya

33. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

34. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

35. Nagka-bungang-araw si Baby dahil sa sobrang init.

36. Nang umibig siya sa taga-lupang si Ramon, ang kanyang pagka-diwata'y tinalikdan niyang lubos upang mamuhay bilang ganap na tao.

37. Her decision to sponsor a child’s education was seen as a charitable act.

38. Ang pag-alala sa mga bayani ay isa sa mga paraan upang maipakita ang pagpapahalaga sa kanilang sakripisyo at pagmamahal sa bayan.

39. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

40. May mga kultura na gumagamit ng mga tradisyunal na hudyat sa mga seremonya o ritwal upang iparating ang mga espesyal na kahulugan.

41. Gusto nilang sumakay ng dyipni sa Pilipinas.

42. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

43. The stock market is a platform for buying and selling shares of publicly traded companies.

44. Ang abuso sa kapangyarihan ay nagdulot ng katiwalian sa pamahalaan.

45. Los bebés recién nacidos tienen un olor dulce y tierno.

46. Climbing without proper equipment is incredibly risky and dangerous.

47. Ang bawat isa ay may bahagi sa pagpapabuti ng bayan.

48. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

49. Crush kita alam mo ba?

50. Ganun talaga. Simpleng sagot ko.

Similar Words

High-definitionhighest

Recent Searches

high4thbadpinalakingbayaninaghihikabsukattagabathalapilipinasconsiderarutakpakikipagbabagjuangpalakoliginitgitsaangngumingisiayao-orderpagpapaalaalaoutlinepasinghaltinanggalmagtatakamagsaingworryduraseeeehhhhsamakatuwidformatsalitalupainyatapaglapastanganalitaptaptwo-partydalangmajormakipagtagisantuloy-tuloymagdadapit-haponmagta-trabahopagkakakulongnaghandanghinahangaanpagkakahawaknagdudumalingpinakalutangnapakabagalnangampanyapagtitindakamakalawaikinuwentopagkakataongnapabuntong-hiningaikinakagalitmoviesnakikihalubilobesesdadalopistamukhangpakialammataaassirakelangankinalimutanb-bakitflamencomatatandaguerreromababawkarapatangkinagatelektronikalas-dosesiyudadsementonglumingontig-bebeintelegitimate,hojas,kinakailangannapalakasnapakabutisiniyasatnaupokakayurinnagpabayadmaipagpatuloynakasimangotmisteryosongnapakagalingsikre,tulisannabitawankasamaanmarketing:lumapadmalusogsuzetteinutusannasisilawkakutismakapalnagawamamahalinmensahekumalmanakakainpaghaharutanpambahaymangyayaritumatanglawpagkagalitmakagawanageespadahankapit-bahaypambansanglaterdiwatabanyorestawrannginingisihannagaganappinangalanangkaramihanmaninipislumilipadtumayosampaguitapanibagongnaghihiraptawagniyakapinspiredna-fundgreenhillsagam-agammatatalogrupomakakabaliktanawinvillagehinagpisbakasyonlandlinesuhestiyonnaglokosigurokamakailankayadakilangnagplaypangungutyaaustraliakaninanagwikangmakausapnangyaringsiyammaskinersabongaraw-mbalouwilittleisipankatolikoeleksyoncompletamentemasukolydelserkanilanggasmenumamponbusilakkaawaytasakamays-sorrykatieginaganapuddannelsepangetdaraannatawaalmacenarnewspapersspecializednangingitngitmabutingmaabotsuwailparusangparehasnaglabadaconocidosupuan