Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Si Mabini ay naging pangalawang pangulo ng unang Republika ng Pilipinas.

2. Tinangka niya itong pigilan ngunit huli na ng naabutan niya ang matanda.

3. Gusto kong namnamin ang katahimikan ng bundok.

4. Naghanap siya gabi't araw.

5. Umingit ang sahig ng kanilang barungbarong nang siya'y pumasok.

6. Ang mga dentista ay may mga kagamitan na ginagamit upang masiguro na malinis at malusog ang mga ngipin.

7. Buwan ngayon ng pag-aani kaya si Mang Pedro at ang iba pang mga kalakihan ay nagtungo sa bukod para anihin ang mga pananim nila.

8. Nakakuha ako ng sagot sa brainly.

9. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

10. Limitar la ingesta de alcohol y cafeína puede mejorar la salud en general.

11. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

12. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

13. En af de mest synlige områder, hvor teknologi har gjort en stor forskel, er i elektronik

14. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

15. He is not taking a photography class this semester.

16. Paglingon niya, nakakita siya sa kanyang tabihan ng isang munting palaka na parang nakatinging sa kanya

17. Los motores de búsqueda nos permiten encontrar información específica en línea.

18. Nakaka-in love ang kagandahan niya.

19. Mula sa kinatatalungkuang giray na batalan, saglit siyang napatigil sa paghuhugas ng mumo sa kamay.

20. Maramot siyang magpahiram ng kanyang mga libro dahil takot siyang masira ang mga ito.

21. Napakaseloso mo naman.

22. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

23. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

24. Ang mga magsasaka sa kanayunan ay nag-aapuhap ng suporta mula sa gobyerno para sa kanilang mga pananim.

25. Mababaw ang swimming pool sa hotel.

26. Landet er en af de mest velstående i verden, og dette kan tilskrives en række faktorer, herunder en høj grad af økonomisk vækst, en velfungerende arbejdsstyrke og en høj grad af offentlig velfærd

27. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

28. Tumayo yung lalaki tapos nakita niya ako.

29. Samantala sa malamig na klima, nag-aalaga siya ng mga halaman sa loob ng bahay.

30. Anong oras gumigising si Cora?

31. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

32. Balita ko, maraming restawran sa Boracay.

33. Kulay pula ang libro ni Juan.

34. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

35. Siya ay apatnapu't limang taong gulang at nakapangasawa sa isa sa mga magaling tumugtog ng piyano

36. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

37. Nakakalungkot isipin na hindi na ako makakapakinig ng bagong awitin mula sa Bukas Palad dahil sa pagkawala ni Fr. Manoling.

38. Nakagawian na ng prinsesang mamitas at mamasyal sa tila bang perpekting hardin para lamang sa isang prinsesang katulad niya.

39. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

40. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

41. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

42. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

43. Malapalasyo ang bahay ni Ginang Cruz.

44. Sa ganang iyo, mas epektibo ba ang online classes kaysa sa face-to-face na pagtuturo?

45. Hindi dapat umutang nang labis sa kakayahan ng pagbabayad upang maiwasan ang pagkakaroon ng financial burden.

46. Puwede siyang uminom ng juice.

47. Pagkababa, mabilis na siyang nagyayang umuwi.

48. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

49. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

50. Ang mga batikang mang-aawit at musikero ay karaniwang itinuturing bilang mga alamat sa larangan ng musika.

Similar Words

High-definitionhighest

Recent Searches

doonhighstandtrainingmobilebroadmovinghalagadingginadaheftymasterclientepasinghalroughryancharitabletermscalemakinginteligentesuseimprovewebsiteconsiderknowbeginningletendbituiniginitgitmonitoroftenincludesameeitherreturnedpacemulingallowsbilingactoredit:adaptabilitymanagergapmaibigaymakapaibabawwhileisinagotboholmanakboappnasasakupanefficientmakapilingnapabalikwasiyogospelmunangbinataksystems-diesel-runsourceotherskaugnayannasangardent-ibangwaternogensindelimitedmaingatlumbaytamacondokasapirinpang-aasaradvanceparurusahansagapriseyunlumakastoyhomemagbigayanbateryacarmenkumatokfitwidelyinangcarbonmulighederkarapatanpangalandisseginaganoondahilgiverlipadmeronbangkobecamedibakananrestaurantbalangiyonvetomayamanmarmaingplasahigh-definitiondikyamelectoral1950sdullbabydisyembrelegacydumaanilawpongbumigaynag-replymalihisbumabagpadabogpopularkahilingansonidoconsumekumukuloangkanparkekinainbumotowealthdevelopcivilizationtwo-partyisipasimmakasilongisulatpaglalayagemocioneshinamaktindahanpaaralanhumihingimbricosgagamitniyogbutimagalitbirthdaybighanipadalase-commerce,magisingtinikmantalinosteamshipstalagangxviipumikithiramniyonawitankalaroconvey,umuposandwichskillsnatatanawconclusion,promisetagumpaytiniklinggawingisinamatelephonechristmasbumalikbanalestadoskundimangumisingmabibingiriegabinabaratbook,observation,undeniablekumainkatibayangbiglaanincredible