Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

2. Ang mga hanging taniman ng mga orchid ay gumagawa ng isang maganda at mayabong na tanawin.

3. Ako ay nagtatanim ng mga puno sa aming lugar upang mapanatili ang kalikasan.

4. Ang hindi marunong tumingin sa pinanggalingan, hindi makakarating sa paroroonan.

5. Tila hindi siya sang-ayon sa naging desisyon ng grupo.

6. Sayangnya, acara itu sudah berakhir. (Unfortunately, the event has ended.)

7. Nag shopping kahapon si Tita sa SM.

8. Frustration can also be caused by interpersonal conflicts or misunderstandings.

9. Magkano ang tiket papuntang Calamba?

10. Iyon hong hinog na mangga. Magkano ho?

11. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

12. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

13. Puwede bang pahiram ng asukal? Magluluto ako ng cake mamaya.

14. Hawak nito ang isang maliit na bangos na tig-bebente, sa loob-loob ni Aling Marta.

15. Hindi ka puwedeng pumasok sa unibersidad.

16. Ilan ang mga puno sa bakuran ninyo?

17. Nagalit ang diwata sa ginawa ng madamot na matanda.

18. Hindi ko maintindihan kung bakit kailangan pang magmangiyak-ngiyak dahil sa mga simpleng bagay.

19. Napakalungkot ng balitang iyan.

20. Nangagsipagkantahan kami sa karaoke bar.

21. Alam kong parang biglaan, pero sana pwede ba kita makilala?

22. Mas maganda si Bingbing kaysa kay Jingjing.

23. Sapagkat batay sa turo ng Katolisismo ay nagpasan ng krus at ipinako sa kabundukan si HesuKristo.

24. Kapag may kailangang desisyunan, hindi maiiwasan na magkaroon ng agam-agam sa kung ano ang tamang hakbang.

25. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

26. Dedication is the driving force behind artists who spend countless hours honing their craft.

27. Hindi niya gustong maging nag-iisa sa buhay.

28. Ano ang gagawin ni Trina sa Oktubre?

29. The patient was discharged from the hospital after recovering from pneumonia.

30. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

31. They volunteer at the community center.

32. Hindi dapat natin pabayaan ang ating mga pangarap upang maabot natin ang ating tagumpay.

33. Sa aming mga paglalakbay sa malalayong lugar, natutuwa kami sa mga disenyong mayabong ng mga hardin at parke.

34. Hindi pa ako nakakapunta sa Barcelona.

35. Ang tubig ay kailangan ng tao para mabuhay.

36. Efter fødslen skal både mor og baby have grundig lægeundersøgelse for at sikre deres sundhed.

37. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

38. Ikaw nga ang dumukot ng pitaka ko at wala nang iba.

39. Kucing juga dikenal sebagai pembasmi tikus dan serangga di rumah atau tempat tinggal.

40. Aquaman has superhuman strength and the ability to communicate with marine life.

41. Sa computer nya ginawa ang disensyo ng kanyang invitation.

42. Malayo ho ba ang estasyon ng tren?

43. "Huwag kang matakot, kaya natin ito," ani ng sundalo sa kanyang kasamahan.

44. Dahan dahan kaming nag lakad. Papapunta sa may.. Sigh.

45. Illegal drug traffic across the border has been a major concern for law enforcement.

46. Nung natapos yung pag print, nakita nung babae yung pictures.

47. Les ingénieurs appliquent la science pour créer des produits et des systèmes.

48. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

49. Nakasandig ang ulo sa tagpiang dingding.

50. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

Similar Words

High-definitionhighest

Recent Searches

highpinag-usapanhinding-hindipracticesamountnegativepersistent,malakingpuntanagbababapatrickerrors,currentremembermamasyalkinameriendanakabawinagsinebodegakamiastumindighinanapbantulotmaghatinggabiinintaybrasopitumpongnatalongartistslaborbusloinisumuuwianimturonakadapaipinalitnamumulaklakaniiskokasamapwedesumasagotdesarrollarboxingnagsunurankapatawaranartistaspagsalakaynalalaglagkinikitakalikasannakakunot-noongkaringcommunicatepramisnagtitindapagka-maktolnagtatakbokayanamumulamaasahanhurtigereuulamino-onlinepaghaharutanmagkaibangpaglalabasulyapmakipag-barkadabutasnaaalalamakabawipilipinasmensahekabutihanmanoodhappyhinatidoperativoshinahanapmilyongnagpepekekanilamanonoodhinahaplosmatandangkaraokesagotkambingsadyangmagsimulae-commerce,tasasisterbuhoksalesmaisipkasiparkingutilizardumaansumisidkaugnayanisipstylesstandbubongspendingfatalsumagotmournedtapesinkwalongexcuseabrilclientswarisalaipapaputolchoicemajorcardparagraphsdisappointkaibangklasengthreebeyondpackagingregularmenteprotestahatesettingwithoutlutuindistansyaimagespambansangmakalaglag-pantynatitirajosiehaponasinjamesjackynagkasunogitongcomunicarsemag-alasitloglegendsisangisamatheirkontraipongingayimporilangiikotpagkasabiiigibibangibabahukayhubadhousehoundskyldesmanghikayatfigureskinagalitanhumayogurohotellilikopaghakbanghorsekadalagahanggymhomeshojashiramhindihimighigitpalayanhenryheftyhawlapaskongcreationhandahamakmuchpagputihacer