Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Gamit niya ang kanyang laptop sa proyekto.

2. This can be a good way to grow your wealth over time, but it also carries risk

3. Hindi umabot sa deadline ang kanyang report, samakatuwid, binawasan ang kanyang grado.

4. Ang aking Maestra ay napakabait.

5. Transportmidler er også et område, hvor teknologi har gjort en stor forskel

6. Bawal mag-abuso ng kapangyarihan dahil ito ay isang krimen.

7. The singer on stage was a beautiful lady with an incredible voice.

8. Ang mga biktima ng paggamit ng droga ay dapat bigyan ng tulong upang maibalik ang kanilang kalusugan at makabalik sa normal na buhay.

9. Mag de-dekorasyon kami mamaya para sa kanyang 18th birthday.

10. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

11. Sa ganang iyo, may pag-asa pa ba ang ating mundo sa kabila ng lumalalang polusyon?

12. Yehey! si Mica sabay higa sa tabi ko.

13. The foundation's charitable efforts have improved the lives of many underprivileged children.

14. Napansin umano ng mga eksperto ang unti-unting pagtaas ng temperatura sa mundo.

15. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

16. Huwag ka nanag magbibilad.

17. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

18. Isinaboy niya ang tubig na nasa harap.

19. Many charitable institutions rely on volunteers to sustain their programs.

20. She has written five books.

21. Tapos nag lakad na siya papunta sa may kotse.

22. Bakit sumakit ang tiyan ni Tonyo?

23. Les maladies mentales sont souvent mal comprises et stigmatisées dans de nombreuses cultures.

24. Ang taong lulong sa droga, ay parang nakakulong sa isang piitan na hindi makalabas.

25. A latte is a popular espresso-based drink that is made with steamed milk.

26. Huwag mo nang papansinin.

27. Nakita niya ang isang magandang babae sa kaniyang harapan.

28. Ang kweba ay madilim.

29. Upang magpalago ng mais, kailangan mong magsimula sa pamamagitan ng pagpili ng tamang lugar para sa iyong halaman

30. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

31. Nag hiking kami sa Mt. Makiling.

32. Naku, wala ka naming gagawin sa Davao.

33. Kumaripas si Lito nang makita niyang naglalakad na papalapit ang guro niya.

34. Naibaba niya ang nakataas na kamay.

35. Las heridas en las extremidades pueden requerir de vendajes compresivos para detener el sangrado.

36. Hinanap niya si Pinang.

37. Ang pag-inom ng tsaa tuwing umaga ay isa nang ritwal na nagbibigay ng enerhiya sa kanya.

38. Kailangan ng maraming niyog upang makagawa ng malaking tasa ng pulotgata.

39. The depth of grief felt after losing a loved one is immeasurable.

40. Ano ang ilalagay ko sa kusina?

41. Sinundan naman siya ng mga magulang niya.

42. Les enseignants jouent un rôle important dans la réussite des étudiants.

43. Napag desisyonan ko na. Love is sacrifice, right?

44. ¿Qué edad tienes?

45. Bakit hindi? ang natigilang pagtatanong ni Mariang Maganda habang pinagmamasdan ang malungkot na mukha ng prinsipeng kanyang iniibig.

46. All these years, I have been learning to appreciate the present moment and not take life for granted.

47. They are running a marathon.

48. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

49. Ein frohes neues Jahr! - Happy New Year!

50. Ang mga guro ay humingi ng mga mungkahi mula sa kanilang mga mag-aaral upang mapabuti ang kanilang pagtuturo.

Similar Words

High-definitionhighest

Recent Searches

kalikasanisasamahighipaliwanaglungsodparaespadaiyanugatthingsenchantedgabesamakatwidhvordannaintindihanmismoenglishbayanipriestwonderpagtangisparoroonamagagamitpag-aalalanaggingsaringcanfistsriskberegningermanalolinawayankasinggandanamanhandasoccerhinalungkatilanfluiditybirokatulongkulisapjosephpapasokdosisulatkaguluhanbagayunattendedlabandahilmagkaibabirthdaygumawabalitatinanggaphugisgawintarangkahan,inintaychoirhinabinaglulutolorikahaponlayuninifugaokamayospitaltotoodiyaryobangkailanganmasinopkaarawanprincipalesomfattendemaipapautangmalapitobstaclestradebigyananiyapupuntabahalatuwang-tuwaiwinasiwascriticsmakalawapilitprinsipesupilinoxygennaninirahanngitinagbabagamakikiligocrazyirogpagbabagomasayacasesyelobagamatsapagkatpaglulutocultivatedmisteryoemphasissistemamatangbisigengkantadakinabibilangannakasalubongdisappointmainitumiibigtumunogfatherclaraikawofrecenupangpollutioninalalaapatnapuipinaalammaestrautakpooldahan-dahanbulanapapatungonuevanagdaladuwendejuicetiyakpagkakatuwaancarbonnagsisihanskabtmerenapaiyakmatangumpaypilipinoplatformsmesatuloysapatosnangyaritrensasakaysaramatatagbutterflyitohapdibundokyearfilipinopag-aapuhapngunits-sorrynakauwimatabaputimagdiliminsidentekarapatangyanagwadormangyaridresspalagingprobablementekasaysayansumamatactomakinghinanapnapakahabalumagomatarikiyongpinamilimalumbaycomputersmaestronagsmileguroprobinsyahapagnangalaglagmunangjamesmagtanimtinik