Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "4th"

1. Nakarating ako ng 4th floor at ako pa rin ang pinag uusapan.

Random Sentences

1. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

2. Nakita niya ang isang magandang babae sa kaniyang harapan.

3. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

4. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

5. El nacimiento es el comienzo de una vida llena de aprendizaje, crecimiento y amor.

6. Mayoritas penduduk Indonesia memeluk agama Islam, yang merupakan agama mayoritas di negara ini.

7. Sira ang elevator sa mall, kaya't napilitan silang gamitin ang hagdan.

8. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

9. Si Anna ay maganda.

10. Algunos animales hibernan durante el invierno para sobrevivir a las bajas temperaturas.

11. Hindi ko inakalang siya ang nangahas na maglagay ng graffiti sa pader ng paaralan.

12. High blood pressure is more common in older adults and those with certain medical conditions.

13. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

14. Meal planning and preparation in advance can help maintain a healthy diet.

15. Madalas sya nagbibigay ng pagkain sa pulubi.

16. The exam is going well, and so far so good.

17. Nanalo siya ng award noong 2001.

18. Nagsimula na akong maghanap ng mga magagandang lugar upang dalhin ang aking nililigawan sa isang romantic date.

19. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

20. He thought it was a big problem, but in reality it was just a storm in a teacup.

21. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

22. Ang bahay ni Lola ay palaging mabango dahil sa mga bulaklak na nasa hardin.

23. Kayo din po ba ang nagpapakain sa kanya?

24. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

25. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

26. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

27. She always submits her assignments early because she knows the early bird gets the worm.

28. Kasingtigas ng loob ni Sultan Barabas.

29. Sa sinabi nyang yun napalingon ako ng hindi oras, Ha?!

30. A veces es difícil encontrar buenos amigos, pero cuando los encontramos, vale la pena.

31. Television is a medium that has become a staple in most households around the world

32. May dalawang libro ang estudyante.

33. Limiting the consumption of processed foods and added sugars can improve overall health.

34. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

35. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

36. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

37. Ang mais ay tumutubo nang mabuti sa mainit na panahon, at dapat mong panatilihin ang lupa malambot at madulas sa pamamagitan ng regular na pag-irrigate

38. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

39. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

40. Coffee is a popular beverage consumed by millions of people worldwide.

41. Einstein's work led to the development of technologies such as nuclear power and GPS.

42. Sa tabi ng aming bahay, ako ay nagtatanim ng mga herbs at spices.

43. Ang mga lumang talaarawan at dokumento ay dapat na itinuring bilang mahalagang bahagi ng kasaysayan.

44. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya, at ito ay nagdulot ng interesante at makabuluhan na pag-aaral.

45. No me gusta el picante, ¿tienes algo más suave?

46. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

47. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

48. Ang pagpapalakas ng aking katawan sa pamamagitan ng ehersisyo ay nagbibigay sa akin ng isang matiwasay na pisikal na kondisyon.

49. Ngumiti siya at lumapit kay Maico.

50. Aku sangat sayang dengan keluarga dan teman-temanku. (I care deeply about my family and friends.)

Recent Searches

buskararatingipasoktrackschedulechambers4thsumalabranchesisasamabehaviorefficientinsteadremembereitherworkshopberkeleycurrentabiactorfutureskillbeforecontentngumitiinfectiousbunutanikinalulungkotnandyanfremstilletanawpracticesmadamotpare-parehomagtanghalianfaultpaghanganakaakyattagalmaramotmaibabalikbiologitinawanankasaganaanfuelpalapitmrsrangeumiibigsakimlumbaysalitangpaumanhinmahiramanitokyonilalangturontugonsumpanasasakupanupworkpunsocupidkabarkadamabutimakipag-barkadapang-araw-arawanotherredesmanonoodgenerabarevolucionadotumatawasino-sinoplantasowntinitirhangusalinapapasabaymalamigmag-orderbinibilidancesagutinpalakagumagamitmanamis-namismatagumpaytransparenttumigilsumasambanamanmakasalanangnagpapaigibshockumanopagsambanakaraanmasayalisensyamaaksidentebihiranitomaulitika-50magkakaanakpakikipagtagponakihalubilopamanpanggatonglumagoaminmagsalitasundaloallowingbusyitinagoonlypopularizenasasalinanmagtiwalanilutoelepanteproducirsilangmagulangconectadospamimilhinlorienergy-coalpaki-translateeclipxeoperatekahongsaktangripomayovegasinastalittlenapagodsalesnagliwanagdumaramimarmaingprobinsiyamasyadongtomorrow00amsinghalanilasalbahengmakulitfonoscinenatitirangmedikal1000makapanglamangmangmaliksihalu-halodatuginoonginimbitakatapatjerrypaskoalangannanakawankumakainabundantebinabatabilamang-lupapinalakingnakakitamatitigasnararamdamanpinoytenerboksingtryghedmichaeldyanrawmagkanokasiyahannaglipanangusedpatunayankatagangaaliskinabubuhayexhaustionakingminamasdanventainformed