Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "later"

1. A couple of phone calls and emails later, I finally got the information I needed.

2. Bis später! - See you later!

3. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

4. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

5. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

6. Musk was born in South Africa and later became a citizen of the United States and Canada.

7. Sampai jumpa nanti. - See you later.

8. Sayang, apakah kamu bisa mengambil anak-anak dari sekolah nanti? (Darling, can you pick up the kids from school later?)

9. See you later. aniya saka humalik sa noo ko.

10. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

11. The store was closed, and therefore we had to come back later.

12. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

13. You can always revise and edit later

Random Sentences

1. Pabili po ng tiket papuntang Calamba.

2. Mabuti naman at bumalik na ang internet!

3. Saan itinatag ang La Liga Filipina?

4. Ariana Grande is an American singer, songwriter, and actress known for her wide vocal range and powerful voice.

5. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

6. La música es una parte importante de la educación musical y artística.

7. Sana ay masilip.

8. Nous allons nous marier à l'église.

9. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

10. The ad might say "free," but there's no such thing as a free lunch in the business world.

11. Nasaan si Mira noong Pebrero?

12. Mura lang pala ang bili nya sa kanyang damit.

13. Bakit anong nangyari nung wala kami?

14. Det er vigtigt at have et godt støttenetværk, når man bliver kvinde.

15. Pupunta si Pedro sa unibersidad.

16. Twinkle, twinkle, little star,

17. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

18. Walang huling biyahe sa mangingibig

19. Ipinakita ng dokumentaryo ang mga kaso ng abuso sa mga nakakulong na bilanggo.

20. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

21. Sinubukan kong gumawa ng kakanin gamit ang pulotgata, ngunit hindi ko nagustuhan ang lasa.

22. All these years, I have been striving to be the best version of myself.

23. Sa ganang iyo, mahalaga pa ba ang kultura at tradisyon sa modernong panahon?

24. Les enseignants peuvent organiser des sorties scolaires pour enrichir les connaissances des élèves.

25. Ok ka na ba? tumango si Athena, Mabuti naman..

26. Kung hei fat choi!

27. Sa tamis na dulot ng pag-ibig natin dalawa.

28. The stock market gained momentum after the announcement of the new product.

29. Omelettes are a popular choice for those following a low-carb or high-protein diet.

30. Sa gitna ng galit at poot, nahihirapan akong makapagpatuloy sa aking buhay.

31. Kahit siya ang nauna ay lagi siyang inuunahan ni Ogor sa pagsahod.

32. Libag ang tawag sa duming kumakapit sa katawan na karaniwang galing sa alikabok

33. We have seen the Grand Canyon.

34. Gusto ko pumunta, pero pagod na ako.

35. Nasaktan siya nang salatin ang mainit na kawali.

36. Les employeurs cherchent souvent des travailleurs expérimentés.

37. Sa labis na pagkagalit ipinadakip mismo ng datu sa mga nasasakupan ang misyunerong nangangaral.

38. Sa ganang iyo, dapat bang manatili sa kanilang posisyon ang mga opisyal na hindi epektibo?

39. They have been cleaning up the beach for a day.

40. Wala ho akong dinukot na maski ano sa kanya.

41. Naisahan ng salarin ang mga pulis sa kanilang operasyon.

42. Ang dentista ay propesyonal na nag-aalaga sa kalusugan ng ngipin at bibig.

43. The zoo houses a variety of animals, including lions, elephants, and giraffes.

44. Bumagsak ang nawalan ng panimbang na si Ogor.

45. The journalist interviewed a series of experts for her investigative report.

46. Bahay ho na may dalawang palapag.

47. The website's search function is very effective, making it easy to find the information you need.

48. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga katas ng lupa at kemikal, na maaaring magdulot ng polusyon sa mga ilog at lawa.

49. Elektronikken i et hjem kan hjælpe med at forbedre komfort og livskvalitet.

50. Nag-aalala ako sa mga pinagdadaanan ng aking nililigawan at lagi kong inuunawa ang kanyang mga kailangan.

Recent Searches

developedpootngpuntalaterdemocraticcompartenmajorpshalambusyangkwebangisugaagahallritobroadcastnicecontentpeterbeforeprovidedupworkcornernariningformmuchstatearmedactiontruedoesaddeksamferrerviewsidea:joynaroonplatformsjunjunvisualdecreaseyeahsystembehaviorpatrickintelligencemessagedifferentamountmonitorexplaindedicationstopcablepilingeithertechnologicalanotherbasanagpupuntanakukuhasenatebutterflyhubad-baroagwadorngunitpinag-usapanaumentaramintilasiopaoiglapnangingisaybuhokmaatimphilippineayawkumaripastanghalianglobalmulbayaniimportantesrepresentativesinantokmataliktanimoliviaanyokasamaangnaggalaendviderepeacebatalanfrescopagkaphysicalexpectationsagostosimplengstuffedkinikitanagpapaypayhinandencolorkumirotbilibidnungnamuhaynagbibiroreguleringltobibigyaninfinitypapaanotheypalibhasamainstreamworldmadeinteriormarchpakealamhalikanpancitpinagawaaleberkeleyvirksomhederoktubrekapainsittingstudiedkampeonlucasmagpapakabaitnakikini-kinitamakapangyarihanpilipinasinsteadsikmuranakumbinsitinaasaniikotmatiyakatensyonmuntingmag-asawanatanggapskyldes,bulahumihingalsearchmagselosmaintindihanguidelongsumusulatmagturosumarapperyahanasahankaratulangpramisnaritongangequipomamahalinmesangintramurosbossmacadamiaalas-dosealingfreeincluirpangalanpisarajolibeetuladpinasalamatansobrangyamanhdtvnagdarasalinangdaratingagilasamantalangnamofficeexperiencesrelativelybaguiotagakdiallednatayonapadaandisciplin