Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "later"

1. A couple of phone calls and emails later, I finally got the information I needed.

2. Bis später! - See you later!

3. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

4. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

5. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

6. Musk was born in South Africa and later became a citizen of the United States and Canada.

7. Sampai jumpa nanti. - See you later.

8. Sayang, apakah kamu bisa mengambil anak-anak dari sekolah nanti? (Darling, can you pick up the kids from school later?)

9. See you later. aniya saka humalik sa noo ko.

10. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

11. The store was closed, and therefore we had to come back later.

12. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

13. You can always revise and edit later

Random Sentences

1. Inflation kann die Arbeitsbelastung der Zentralbank erhöhen.

2. Ang mga halaman ay dapat na pinapakain sa regular na may compost o fertilizer upang matiyak na sila ay may sapat na nutrients para sa paglaki

3. El agricultor utiliza técnicas de riego para asegurar el crecimiento óptimo de sus cultivos.

4. Bilang paglilinaw, ang impormasyon ay nakuha mula sa opisyal na website, hindi sa social media.

5. Musk has been involved in various controversies over his comments on social and political issues.

6. La calidad del suelo es un factor clave para el éxito de los agricultores.

7. Pinayuhan sila ng albularyo na magdasal bago mag-umpisa ang gamutan.

8. Nagpapalabas ng horror movie ang TV network ngayong hatinggabi.

9. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

10. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

11. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

12. Ito ay alay nila bilang pasasalamat kay Bathala.

13. Børn skal have mulighed for at udforske og lære om verden omkring dem.

14. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

15. Tengo una labradora negra llamada Luna que es muy juguetona.

16. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

17. Masayang-masaya ako ngayon dahil nakapasa ako sa board exam.

18. Kung may tiyaga, may nilaga.

19. Baby fever is a term often used to describe the intense longing or desire to have a baby.

20. Mahirap hanapin ang kasagutan sa kaibuturan ng suliranin.

21. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

22. Nakatira si Nerissa sa Long Island.

23. Sinimulan ko ng i-collect lahat ng bibilhin.

24. Sa pagbisita sa hardin, ang mga bulaklak ay nagbigay ng mabangong amoy at kagandahan sa kapaligiran.

25. Mathematics is an essential tool for understanding and shaping the world around us.

26. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

27. Napakahusay nga ang bata.

28. Me duele el estómago. (My stomach hurts.)

29. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

30. Napatulala ako sa kanya. Di ko alam ang isasagot ko.

31. Guten Tag! - Good day!

32. Gusto niyang lumayo at maglakbay palayo sa lugar ng kanyang kabataan.

33. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

34. Ang kaulayaw ay mahalagang bahagi ng buhay ng isang tao.

35. The Petra archaeological site in Jordan is an extraordinary wonder carved into rock.

36. Pumunta daw po kayo sa guidance office sabi ng aking teacher.

37. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

38. Sa kanyang huling araw sa opisina, nag-iwan siya ng liham ng pasasalamat sa kanyang mga kasamahan.

39. Noong Southeast Asian Games, nag-uwi si Carlos Yulo ng maraming medalya para sa bansa.

40. Superman possesses incredible strength and the ability to fly.

41. Some people like to add a splash of milk or cream to the beaten eggs for a creamier texture.

42. Ang mapa ng mundo ay nagpapakita ng lahat ng mga bansa sa buong mundo.

43. Apa yang bisa saya bantu? - How can I help you?

44. Omelettes are a popular choice for those following a low-carb or high-protein diet.

45. Masasabi ko na ang mga kanta ng Bukas Palad ay nagbibigay sa akin ng kapayapaan at kapanatagan.

46. Ang mag-aaral ay nagsusulat ng mga sanaysay at mga ulat bilang bahagi ng kanilang mga proyekto.

47. Dahil sa pagtaas ng populasyon sa bansa, yumabong ang pagtatayo ng mga condominiums at mga townhouses.

48. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

49. Bawat eskwelahan ay may kanya kanyang alituntunin.

50. Nakatingin siya sa labas ng bintana, waring may hinihintay.

Recent Searches

congratsminutelaterpagpapakainferrerlimitfacilitatingbadresultbarpasswordtalentphonecontrolawhichvanwhybroadcastsoffentligipagtimplamagkakaanakvirksomhederpagsumamolaamangplacedarnamantikaeconomicngipingbawalnakatingindietforståtaongwristpiecesaalisnaritolegislativealeplaysinformedmagbubungasakalingbinitiwanbusiness:twinkleiniirogmismogotnag-angatiintayintatawagobservererpanghabambuhaytumubongorderinpamumunopambatangnangyarilalakadtinakasankakataposkumikilosmagtiwalatumutubomananahipuntahanenviarpaosintensidadnapasubsobasukalprotegidokalaronaantiginastaawardmalilimutankainankatulongtinderainiisipalaksantoskenjismilesalitaadvancecarmentsssinimbitatugonpalakapakealamhinogilawsundaeuntimelynahulinasabingdiagnosticnakabuklatblusangfonoswalaboksingtodayredesfurybroadcastfeltwelluseddogscientistresearchperlagelaihardagilitysincepasangtripcoachinganimipapainitseendoseksenanaroonclockpacebitbitbasagapipihitnilalangromanticismomasanaynakatunghaykonsultasyonmagtataasninaipinauutangforskel,ipagamotnapalitangboseshistoriamakakaluneshvormagsimulaseeklipatnaminnalamanpamasaheinvestpagkainisprojectshouseholdsnagbantaytatayopeaceanongboracaybitiwansipatoretegodtnunorevolutionizednagliliwanagmaipantawid-gutomkapangyarihanmagpaliwanagmagpaniwalamakikipagbabagmagnakawnakaka-inkonsentrasyoncrucialsinasadyatungawpinagkiskisnangangaraltuluyanpagtataposcompanydropshipping,americainiindasenadorkuryentemagpahabapitumpongnewsbalikat