Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "cover,"

1. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

2. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

3. Don't underestimate someone because of their background - you can't judge a book by its cover.

4. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

5. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

6. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

7. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

8. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

9. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

10. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

11. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

12. You can't judge a book by its cover.

Random Sentences

1. Mathematical formulas and equations are used to express relationships and patterns.

2. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

3. Maraming paniki sa kweba.

4. Mapapansin kaya sa dami ng 'yong ginagawa

5. Some people have a sweet tooth and prefer sweet flavors over others.

6. May mahalagang aral o mensahe na ipinakilala sa kabanata, naglalayong magbigay ng kahulugan at kabuluhan sa kwento.

7. Lapat na lapat sa kanya ang kamisetang iyon noong bagong bili ngunit ngayo'y maluwag na.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. Nagsimula na akong maghanap ng mga magagandang lugar upang dalhin ang aking nililigawan sa isang romantic date.

10. Talaga? Sige nga ipakita mo nga saken.

11. Hindi man nanalo sa halalan, bagkus ay binati pa rin nang natalong kandidato ang bagong mayor.

12. Les astronomes étudient les étoiles et les galaxies.

13. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

14. Grabe ang lamig pala sa South Korea.

15. Nagtatampo na ako sa iyo.

16. Sa Chinese New Year, ang mga tao ay nagpapakasaya at nagdiriwang ng malakas.

17. The early bird gets the worm, but don't forget that the second mouse gets the cheese.

18. Nakakuha kana ba ng lisensya sa LTO?

19. There are a lot of opportunities to learn and grow in life.

20. Dapat nating bigyan ng halaga ang mga taong nakapaligid sa atin, datapapwat ay hindi natin palaging nakakasama sila.

21. Las escuelas ofrecen actividades extracurriculares, como deportes y clubes estudiantiles.

22. kami kumikilos mula sa kinatatayuan namin.

23. Ang pagiging malilimutin ni Leah ay dala ng labis na pagkaabala sa trabaho.

24. Nangyari ang isang malaking proyekto sa aming lugar dahil sa bayanihan ng mga residente.

25. The chef is not cooking in the restaurant kitchen tonight.

26. "Mahalaga ang kalusugan, kaya alagaan natin ang ating katawan," ani ng doktor.

27. Gusto kong matutong tumugtog ng gitara.

28. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

29. Claro, podemos discutirlo más detalladamente en la reunión.

30. Pagkuwa'y bigla na lamang nitong kakayurin ng hintuturo ang balat sa kanyang batok.

31. Las serpientes tienen una mandíbula flexible que les permite tragar presas enteras, incluso si son más grandes que su propia cabeza.

32. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

33. It's raining cats and dogs

34. Miguel Ángel Buonarroti fue un artista italiano del Renacimiento.

35. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

36. Ang batang matuto, sana sa matanda nagmula.

37. Chumochos ka! Iba na pag inlove nageenglish na!

38. Ang hindi magmahal sa sariling wika, ay higit pa ang amoy sa mabahong isda.

39. Pagtataka ko kung bakit hindi mo pa rin napapansin ang aking mga ginagawa para sa iyo.

40. Climbing without proper equipment is incredibly risky and dangerous.

41. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

42. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

43. Medarbejdere kan blive tildelt forskellige arbejdstider, som natarbejde.

44. Setelah kelahiran, calon ibu dan bayi akan mendapatkan perawatan khusus dari bidan atau dokter.

45. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

46. We were planning on going to the park, but it's raining cats and dogs, so we'll have to stay indoors.

47. Paano ho pumunta sa Manila Hotel?

48. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

49. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

50. Bless you.. tugon ko sa biglang pagbahing nya.

Recent Searches

cover,kinatatakutanbusyangnawalangtumingalatrasciendesumusunodpagpapasakitnakukuhalagnatnanlilimahidinspirebyeginangkasyamagagandangkondisyonpinag-usapantelevisionsumasagotgusting-gustoteachingshometumitigilparksteamshipspagkataokapainknightputiherramientasoccerpangambabateryangunitmantikaparehongpambansanggardentubig-ulanmadulasnampangangailanganpayadditionally,kumukuhapakistanhinamakindividualseasylibertyalmusalbilaojunepakikipaglabanhvertignaniniirogeffectsmakasilongmaawaingpioneernaglabanannag-oorasyonbumabahakalabawayonkanoestudyantesutilapelyidonapabayaanmaabutanmaghandaeyekalaunanaywanboyfriendmabutipagpiliobviousattorneycontinueinabutanbutikinangapatdannagsisipag-uwianmaagapanelektroniknasasakupannatutuwainilalabasencountermatakotwayspagodunanreserbasyonhimutokkinantarebohonestogodpagkapasokplatformsumiinomdecreasedreplacednathanpeer-to-peerbumahavirksomheder,kagipitanfestivaleslaganapdosenangkamalianmag-isapasyalanmerchandisefacebookikawkantaintelligencenanigaspaga-alalanagpipikniknalalabikarwahengalas-diyespupuntahanmagbayadnaibibigaykakayanangkamakailannaulinigannareklamonapapahintohulumagsugalkatutubocompanydollytrabahovaccinesnasaanmagsasakamagtatakanabuhayiligtasuncheckedmismonagkakilalaliligawannasunoghumihingaleroplanosunud-sunodphilippinenapilitangrosellepulistinanggapanainfluencesrewardingkarangalanlottoparangsawapalaginakatingingamographicmeaningbilugangsweetbio-gas-developingnuontwo-partychoicecollectionsfridayhintuturopadernag-uwibossdinmatamisidinidiktafriesbusinessesexpectationshvortransitcourthundredactionfaractivity