Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "cover,"

1. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

2. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

3. Don't underestimate someone because of their background - you can't judge a book by its cover.

4. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

5. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

6. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

7. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

8. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

9. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

10. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

11. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

12. You can't judge a book by its cover.

Random Sentences

1. The acquired assets will improve the company's financial performance.

2. Using the special pronoun Kita

3. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

4. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

5. La música puede ser una forma de protesta y expresión de descontento.

6. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

7. Nakain na nito ang lasong bunga at unti-unti na itong nangingisay at bumubula ang bibig.

8. Anong wala! pasinghal na sabi ni Aling Marta

9. Los amigos que tenemos desde la infancia suelen ser los más cercanos y leales.

10. May bakante ho sa ikawalong palapag.

11. Sa baguio nila napiling mag honeymoon.

12. Gusto kong tumakbo at maglaro sa parke.

13. Buhay ay di ganyan.

14. Masyadong ganid sa salapi ang taong iyon.

15. The objective of football is to score goals by kicking the ball into the opposing team's net.

16. El cultivo de hortalizas es fundamental para una alimentación saludable.

17. Ako naman, poker face lang. Hahaha!

18. Natawa na lang ako, Oo nga pala, ano nga ulit tanong mo?

19. Sa pag-alis niya sa tahanan, nag-iwan siya ng mga alaala at mga kuwentong puno ng pagmamahal.

20. Twitter allows users to send direct messages (DMs) to each other for private conversations.

21. Ano ang gustong sukatin ni Andy?

22. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

23. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

24. ¿Quieres que le agregue un poco de picante a tu comida?

25. Gracias por ser una inspiración para mí.

26. Cutting corners might save time now, but it will cause problems down the line.

27. Nang magkaharap ang mag-ama, ang kanyang ama ay hindi niya ito tinanggap

28. Ang pagsasayaw o pagsali sa isang grupo ay nakagagamot sa aking kaluluwa.

29. Hindi maganda na maging sobrang mapanghinala sa lahat ng tao dahil sa agam-agam.

30. Limitar el consumo de alimentos procesados y azúcares añadidos puede mejorar la salud en general.

31. Anung email address mo?

32. Gusto ko lang magpaalam nang maayos, kaya sana pwede ba kita makilala?

33. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

34. Sa gitna ng buhawi, ang makabagong teknolohiya tulad ng Doppler radar ay ginagamit upang masubaybayan at maipabatid ang lakas at direksyon nito.

35. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

36. Dedication is what separates those who dream from those who turn their dreams into reality.

37. Balak po naming bumalik sa susunod na linggo.

38. Nationalism has been a driving force behind movements for independence and self-determination.

39. Scissors have handles that provide grip and control while cutting.

40. Me encanta enviar tarjetas de amor en el Día de San Valentín a mis amigos y seres queridos.

41. Madilim ang kweba na kanilang pinasok.

42. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

43. The use of emphasis is influenced by cultural and social norms.

44. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

45. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

46. Every year on April Fool's, my dad pretends to have forgotten my mom's birthday - it's a running joke in our family.

47. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

48. Ang pagpapalakas ng aking katawan sa pamamagitan ng ehersisyo ay nagbibigay sa akin ng isang matiwasay na pisikal na kondisyon.

49. Inumin mo ang gamot nang minsan isang araw.

50. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

Recent Searches

cover,josiekampanagumigisinghonestonaghuhumindigantestakotkaninaminerviekabighaadvancementtinanggallolamatagalindustriyadamdaminpinakatuktoklarangannaalistsinelaspampagandapangakokasingtigascitizentarcilamartesutilizabeautifulnakikilalangdatabritishmungkahilenguajekarapatanartethankrisemabaliktagaytaymestkabosessenatebigotealexanderagosnanlilimahid18thoutpostritwaleeeehhhhthemperacakeinuminworrydulostoprecentgotblessstreamingkapangyarihanmagbayadnakangisisnobcomputerboholnasugatannungbayadpagdiriwanghumpayaanhinginugunitaamingenforcinglutosugatangtatagalpronounmadamisiguroplasamabagalmadungisgroceryhinalungkatibajackbihasaganunbilhinbroadcastsfuncioneseuphoricpakiramdambateryapaksapaanoaywankindleswimmingmasaksihanphilippineanjoeksporterermaglalakadstatingnakakainmagbabagsiklupalopkaliwagayunmanparoroonacollectionskanconsistkinsekutodcarbonumingitdietmelissamakalipasnakakaalampaggitgitaraypeeplumayasbrindarmoderneestarpowerpointmagisipbuwenaskastilanggandakanikanilanglabasalignsfeedback,magpuntakabutihandoktorkonsultasyonnapakadahonpagbabayadmagbalikpambahaynaistilabesesmasukolhurtigeremamalasuulamindinukotpatipagkakatuwaanikinatatakotnagkasunognagliliyabisinulato-onlinemagsugalmagpakaramisasapakinlibertysetyembrelarongbumilikaugnayanoveralldakilangberetibaronginterviewingshouldtechnologiesallowedboxnatingsecarsekamimalimitnanalokurbatapinagsikapannakatitigarawbinibilipinalakingspecialanumanglinggo-linggoilanpayopaghihingalo