Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "cover,"

1. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

2. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

3. Don't underestimate someone because of their background - you can't judge a book by its cover.

4. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

5. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

6. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

7. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

8. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

9. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

10. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

11. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

12. You can't judge a book by its cover.

Random Sentences

1. La música que produjo el compositor fue muy innovadora para su época.

2. Naghanda sila para sa kasal na gagawin sa bundok.

3. Denne kombination har vist sig at være meget effektiv i at skabe en høj grad af velstand og velfærd for befolkningen

4. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

5. Ang paglapastangan sa mga karapatan ng mga katutubo ay nagpapakita ng di-pagkakapantay-pantay sa lipunan.

6. Elektronik er en vigtig del af vores moderne livsstil.

7. Hormonbehandling og kirurgi kan have forskellige risici og bivirkninger, og det er vigtigt for transkønnede personer at konsultere med kvalificerede sundhedspersonale.

8. Bakit ganyan buhok mo?

9. Maarte siya sa mga lugar na pupuntahan kaya hindi siya nakikipagsiksikan sa mga madaming tao.

10. Tengo fiebre. (I have a fever.)

11. Hindi ko gusto ang takbo ng utak mo. Spill it.

12. Ang aking kabiyak ay palaging nasa tabi ko sa hirap at ginhawa.

13. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

14. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

15. May I know your name so we can start off on the right foot?

16. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

17. The dog barks at strangers.

18. Siya ay nangahas na mag-apply sa isang prestihiyosong unibersidad kahit mababa ang kanyang kumpiyansa.

19. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

20. Kebahagiaan bisa ditemukan dalam momen-momen kecil sehari-hari.

21. They are singing a song together.

22. Bawal magpaputok sa kalsada dahil ito ay nakakabahala sa kapayapaan ng mga tao.

23. Nagtagisan ng galing ang mga maghahabi.

24. Iyong kulay itim na bag ang bag ko.

25. Hindi pinakinggan ng Ada ang abuhing Buto ng Kasoy.

26. Halos gawin na siyang prinsesa ng mga ito.

27. Pets, including dogs, can help children develop empathy and responsibility.

28. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

29. If you keep beating around the bush, we'll never get anywhere.

30. I need to check my credit report to ensure there are no errors.

31. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

32. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

33. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

34. Naging mayabong ang kaalaman ng tao dahil sa teknolohiya.

35. Nagkakasya rin ang pamilya na mamulot ng mga tirang pagkain na maaari pang pakinabangan.

36. Pinagsulat si Jayson ng pangungusap sa pisara.

37. Ano hong pitaka? ang sabi ng bata.

38. Sumakay sa jeep ang mga pasahero nang limahan.

39. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

40. La amistad entre ellos se fortaleció después de pasar por una experiencia difícil.

41. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

42. She has been working on her art project for weeks.

43. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

44. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

45. Ah talaga? Oo nga nuh, nung niyakap kita namula ka.

46. I have received a promotion.

47. Ang blogger ay nagsusulat ng mga blog post upang ibahagi ang kaniyang mga opinyon at karanasan.

48. Ang aming mga hardin sa paaralan ay mayabong na tanim na kinakailangan naming alagaan.

49. Napakahalaga ng pag-unlad ng mga pagsasaliksik sa talambuhay ni Apolinario dela Cruz bilang isang relihiyosong lider.

50. Los agricultores pueden desempeñar un papel importante en la conservación de la biodiversidad y los ecosistemas locales.

Recent Searches

cover,pag-aaralmakikitatakottelevisionconpagsasalitatemparaturapagdatingpinggaloryipagmalaakimaghahandaipinatawagbusilaktitiralalakingcontrolledsanastenidodiwatangbillsumubopagkainisimpactedmissnakikihukayimproverestaurantbirthdayparolnewmahahanayiyamotnamasyaltennisawardsuchkababayanstuffedaywanluluwasjeepneykauna-unahangpinamalaginalalarodonationsmasinopthankrisktuwinglarawantalapag-unladnagtitindababaesamakatuwidoperahansuwailtherenakakunot-noongsinipangtataytagalogterminobasurapagdukwangnapatayorecibirhacerperapinakabatangbakitpagkatoccidentalmapakaliganapinthankssaymaghaponpaanomapadaliprovebagkus,thanksgivinglongpulgadabinabaratestasyoninspirebahagyafastfoodpagbabasehansizekayanabighanitinamaandulotthenlumipaskinsekunghvorwalngeducativastherapeuticsagam-agamulaphaponcreatedthereforedingdingdibisyonkahitninyongimbesdisenyotheseiskopatuloytumutubopinakawalanmarangyangkumbentokamukhakaibiganbilhinvideonaiwankalaunanhanggangabangantemperaturahudyattinderaalamidthoughredbilugangakinthreemagbibiladklasengespanyolkapainmagka-apothroughoutreynabibilidaigdignakabaontibokkikoinspirasyonflightkalawakanclassroomtanawinticketdaangspeedpaghangagutomsundaemag-galamahahawamarketingbackpackultimatelycitylumungkotpersonasiyontiemposhelpnanggigimalmalmabangislending:safernakikilalangkundimanbilingkumakainkapilinghjemstednakapapasonggusting-gustohistoriagumisinggasolinafilipinonahahalinhanentoncesemphasisiyongdaraanannaguguluhangculturalconstantniyang