Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "dolly"

1. May dalawang kotse sina Dolly at Joe.

Random Sentences

1. Ang kalawakan ay punung-puno ng mga bituin.

2. Nagsisilbi siya bilang security guard upang protektahan ang mga tao at ari-arian.

3. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

4. Isa daw siyang mabangis na hayop dahil tulad nila meron din siyang matatalim na mga pangil.

5. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

6. Break a leg

7. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

8. The stock market can be influenced by global events and news that impact multiple sectors and industries.

9. Ang pag-asa ay nagbibigay ng mga solusyon sa mga suliranin at hamon na kinakaharap ng mga tao.

10. At tilgive os selv og andre kan være afgørende for at have en sund samvittighed.

11. Pinagpalaluan ng bayan ang kanilang mayor dahil sa kanyang mga proyekto at serbisyo publiko.

12. Siguro matutuwa na kayo niyan.

13. Kinuha nito ang isang magbubukid at agad na nilulon.

14. Naku, wala ka naming gagawin sa Davao.

15. Patuloy ang labanan buong araw.

16. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

17. Waring hindi pa handa ang kanyang puso na magmahal muli.

18. Ignorieren wir unser Gewissen, kann dies zu einem schlechten Gewissen und Schuldgefühlen führen.

19. Facebook Events feature allows users to create, share, and RSVP to events.

20. Salatin mo ang pader at hanapin kung saan ang crack.

21. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

22. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

23. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

24. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

25. Hindi ibig sabihin na kuripot ang isang tao ay madamot na ito.

26. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

27. The dog barks at strangers.

28. Terima kasih banyak! - Thank you very much!

29. Kukuha lang ako ng first aid kit para jan sa sugat mo.

30. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

31. Dogs are often referred to as "man's best friend".

32. It is important to have clear goals and expectations in the workplace.

33. They have been volunteering at the shelter for a month.

34. Hindi dapat natin ipagkait ang mga oportunidad na dumadating sa atin, datapapwat ay hindi ito madaling makamit.

35. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

36. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

37. At vedligeholde en regelmæssig træningsrutine kan være udfordrende, men belønningerne for ens sundhed og velvære kan være betydelige.

38. But in most cases, TV watching is a passive thing.

39. Sa hirap ng sitwasyon, nangahas siyang humingi ng tulong mula sa mga estranghero.

40. Fui a la fiesta de cumpleaños de mi amigo y me divertí mucho.

41. Ipinagbabawal ang paglapastangan sa mga simbolo at sagrado ng mga kulto at relihiyon.

42. Jeg har aldrig følt mig så forelsket før. (I've never felt so in love before.)

43. He admires the honesty and integrity of his colleagues.

44. Hindi ko lang sya pinansin at iniling lang ulit ulo ko.

45. Electric cars have a lower center of gravity, which can improve handling and stability.

46. Buhay ay di ganyan.

47. Ano ang gagawin ni Trina sa Disyembre?

48. Natawa nanaman sya, Hindi, maganda sya.

49. Ang digmaan ay maaaring magdulot ng pagbabago sa pamamahala ng isang bansa.

50. Ipinagbibili ko na ang aking bahay.

Recent Searches

dollysabadonapapikitoutpostworkdaysiksikanlandlinenagpakunotnaglaonlumbaynapapag-usapanmisusedsusiinterpretingbumaliknangangalogkawili-wiliearlyeksport,luisgayaramdampagkaawaamerikaclearbusilakpagkuwanbagkus,pinoymatalikyorkaksidentenagwagibinibiniisusuotmadalingaktibistayourself,tuwingestospagkalungkotsystematiskconclusion,pinsandinaluhanpagkasabiiligtasnapakahangakayaseryosongnakaliliyongbulaklakpagsasalitatatagalnabighaniphilanthropyobservererhahatolsalamangkeropupuntahantindamaisusuotnakapasaunosmaestraconditioningsambittusonginagawglorialayaspopcorncivilizationinatakebairdtonighthusosinagotnowcapitalalexandertapemalayangwalongpumatolnakatingingtagabilanggofreekumarimotcoinbaseperangstevekaringginisingpedroipagamotlabanorugafakeownvampiresanibecamefrescotoyiskedyulnamakaugnayanwaterenergifatherautomationkunwasakimpagkatiigibenforcingpalmabahagiputireportfascinatingdinalareststudentsbridemakilingcountriesplaysfuncionesnuclearcomeeveningautomaticimpactedelectedhelloaggressionilingbetarawalsorecentstatingeasyjuniopotentialxixtindahanditopresence,umakyatpaki-basaimpactculpritlumibotoperativoslakinaiilaganrefersrosellepag-aaniglobalisasyonsonidomahiwaganananaghilicrazypatungofollowing,peppytarcilanamamayatpabulongnagpatulongitutoltumalonkatedralprovidedcomparteneuphoricdeljeepneyibinubulongnatagalansusunduinpinakamalapitkisshmmmmnagc-cravekumakainlacsamanaseriousbilihingumandanaghubadabut-abotpropesorumisipkalupi