Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "unique"

1. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

2. His unique blend of musical styles

3. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

4. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

5. Many cultures have their own unique traditions and customs surrounding weddings.

6. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

7. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

8. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

9. The fashion designer showcased a series of collections, each with its own unique theme and style.

10. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

11. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

12. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

13. Think about what message you want to convey, who your target audience is, and what makes your book unique

Random Sentences

1. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

2. "A house is not a home without a dog."

3. Kalimutan lang muna.

4. Sa pulong ng mga magulang, ibinahagi nila ang mga mungkahi para sa mas magandang edukasyon ng mga bata.

5. La boda de mi amigo fue una celebración inolvidable.

6. Sino ang susundo sa amin sa airport?

7. The disagreement between them turned out to be a storm in a teacup.

8. Nahulog ang bola sa dagat kaya lumangoy si Rico para kunin ito.

9. Iilan pang taon ang nakalilipas sa kanyang pagka-Datu nang siya ay nagkaroon sa kanyang kabiyak ng isang tagapagmana ng kaharian.

10. Esta comida está bien condimentada, tiene un buen nivel de picante.

11. ¿Dónde está el baño?

12. The children play in the playground.

13. El nacimiento de un bebé es motivo de alegría y celebración.

14. Ang saranggola ni Pedro ay mas mataas kaysa sa iba.

15. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

16. Di na ako magtataka dahil alam ko naman ang nangyari.

17. Pull yourself together and focus on the task at hand.

18. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

19. El accidente produjo un gran tráfico en la carretera principal.

20. L'intelligence artificielle peut être utilisée pour prédire les résultats des élections et des événements futurs.

21. Humayo kayo at magpakarami! ayon ang biro ni Father Ramon.

22. The market is currently facing economic uncertainty due to the pandemic.

23. Pakibigay mo naman ang libro kay Anna para magamit niya sa kanyang takdang-aralin.

24. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

25. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

26. Hindi ako sang-ayon sa mga komento na narinig ko tungkol sa iyo.

27. Les enseignants doivent évaluer les performances des élèves et leur donner des feedbacks constructifs.

28. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

29. Palibhasa ay may malalim na pag-unawa sa mga komplikadong konsepto at ideya.

30. Sa pook na iyon, sa nakaririmarim na pook na iyon, aba ang pagtingin sa kanila.

31. Natakot umano ang mga estudyante nang marinig ang kwento tungkol sa multo sa eskwelahan.

32. Pull yourself together and show some professionalism.

33. Sumasakay ako ng taksi sa umaga araw-araw.

34. Hindi ko pa nababasa ang email mo.

35. Itinaob niya ang kaunting nasahod na balde at ang tubig ay gumapang sa semento at umabog sa kanilang mga paa ni Ogor.

36. Medarbejdere kan skifte karriere når som helst i deres liv.

37. Bilang panghabambuhay na parusa ay pinamalagi ng Adang manatili sa labas ng Kasoy ang abuhing Buto nito.

38. Napasuko niya si Ogor! Napatingala siya Abut-abot ang pahingal.

39. Nagpakita sa Datu ang Dakilang Bathala at ipinaalam sa ama na ang kanyang anak ay mabubuhay ng labing-siyam na taon lamang.

40. Oh ano na? Hindi ka na sumagot?

41. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

42. Isang linggo nang makati ho ang balat ko.

43. Bawal magpakalat ng basura sa kalsada dahil ito ay maaaring makasira sa kalikasan.

44. La santé est un état de bien-être physique, mental et social complet.

45. The influence of a great teacher on their students is immeasurable.

46. "You can't teach an old dog new tricks."

47. Ngunit natatakot silang pumitas dahil hindi nila alam kung maaring kainin ito.

48. Hindi malaman kung saan nagsuot.

49. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

50. Sa Chinese New Year, ang mga tao ay nagbibigay ng mga pabuya upang pasayahin ang mga diyos at mga espiritu.

Recent Searches

scaleuniquemagbigaystarmang-aawitnasasabihanh-hoynakayukorektanggulomasasabivillagenahigitannakabiladhinanapnapaagaganundasalmatikmanassociationkamatisinakyatlabormaitimoutlinesmainitmapapatipidevolvedstageoftenownkinakitaannabagalannakakatawapinag-usapannakangisimagbayadpinunitsuotfysik,masaksihanvictorialonglandetandoybabaingpaosmabagalsugatangmilyongmantikakargahannakatinginkalongtulangsalaconsistlegislativeconditioningalemacadamiadinmanghikayatstatinghalagaestablishedsalu-salogratificante,kamandagselebrasyonihahatidpumitassay,principalesnagbagoproducererlandlinepagkasabikonsentrasyonkanayongarbansoslabisbenefitsmaritesvegasydelserpusalagunaenergitamalookedpetsangmisusedbabaetrygheddidingkasamangdyansquatterideaelectedbroadcastingerrors,amazonbobouminommangangahoymagsubomahinogsagasaanmakikiligohampaslupalumayototoongmagtatanimnilaosvideosmakisuyosunud-sunodhawlamusiciansligaligbinatilyocrushkunwakabuhayancompositoresnagsisigawseguridadgaglimitedmedyoipinasyanglotbotantefremtidigeawahiniritunoseksenasamakatwidmaglalakadagilitynagreplycampnakukulilistudiedliveeffectssystemnagkakatipun-tipongayundincommunicationsatensyonunangmalakingpagkakayakapnamumuongnakadapatungawpagkapasokkubyertosmontrealmusicalestemperaturakaninomagka-apoipagtanggolnatatawamakaiponmasayanaapektuhanfiverrteachingsvelfungerendeartistaspaumanhinconsumereviewestiloslaruanginhawabarogamitinorderinpostcardlabingmaaringfonopupuntahintayincontrolledmarkedlasinghellotumayobusilaktrapikkabiyakmatutong