Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "unique"

1. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

2. His unique blend of musical styles

3. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

4. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

5. Many cultures have their own unique traditions and customs surrounding weddings.

6. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

7. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

8. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

9. The fashion designer showcased a series of collections, each with its own unique theme and style.

10. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

11. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

12. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

13. Think about what message you want to convey, who your target audience is, and what makes your book unique

Random Sentences

1. Su obra más famosa es la escultura del David en Florencia.

2. Na-promote ako sa higher position sa aking company kaya masayang-masaya ako ngayon.

3. Ilang tao ang nahulugan ng bato?

4. Diyos ko, ano po itong nangyayari sa aming anak?

5. Sadyang mahirap ang pag-aaral ng calculus.

6. Nag-aaral siya sa Seasite bawat araw.

7. Ang tubig-ulan ay tumutukoy sa ulan na mayaman sa tubig at mahabang tagal.

8. Pinapakain ng pulotgata ang mga langgam sa aming bakuran.

9. Tumawag ako kaninang umaga pero wala ka.

10. She is not cooking dinner tonight.

11. The children are not playing outside.

12. Leukemia can affect people of all ages, although it is more common in children and older adults.

13. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

14. Hindi dapat natin hayaang mayroong paglapastangan sa mga pangalan ng mga namayapa.

15. Isang araw sa kanyang pamamasyal ay may nakilala siyang isang bagong mukha.

16. I am not watching TV at the moment.

17. Musk has expressed a desire to colonize Mars and has made significant investments in space exploration.

18. Landbrugsprodukter, især mejeriprodukter, er nogle af de mest eksporterede varer fra Danmark.

19. Sino yung naghatid sayo? biglang tanong niya.

20. He is not driving to work today.

21. Lumapit sakin si Kenji tapos naka smile siya.

22. May konsiyerto ang paaralan at ang mga guro ang magiging bida.

23. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

24. Ang gusali sa tabi ay mababa kumpara sa bagong itinayong opisina.

25. Ang kalayaan ay nangangailangan ng responsibilidad at disiplina.

26. Pagpasensyahan na daw niya ito dahil iyon na lamang ang natitira niyang pagkain.

27. If you want to get the best deals at the farmer's market, you have to be the early bird.

28. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

29. The momentum of the athlete propelled him across the finish line.

30. Los colores cálidos, como el rojo y el amarillo, transmiten energía en una pintura.

31. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

32. Walang kasing bait si daddy.

33. Nasa Cebu si Trina sa Disyempre?

34. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

35. Ang calcium ay kailangan ng ating katawan upang tumibay pa ang buto.

36. Ang sugal ay nagdudulot ng pagkawala ng kontrol at pagkakaroon ng mga labis na panganib.

37. Anong oras gumigising si Katie?

38.

39. Pinahiram ko ang aking golf club sa aking kaopisina para sa kanilang tournament.

40. Twitter is also used by businesses and brands for marketing, customer engagement, and brand promotion.

41. Tumingin ako sa direksyon kung saan sya nagtatrabaho...

42. Ang mga nagliliyab na bulaklak sa hardin ay nagbigay ng makulay na tanawin.

43. Les algorithmes d'intelligence artificielle peuvent être utilisés pour optimiser la consommation d'énergie dans les bâtiments.

44. After months of hard work, getting a promotion left me feeling euphoric.

45. La creatividad es fundamental para el desarrollo de ideas innovadoras.

46. The company's financial statement showed an increase in acquired assets.

47. Biglaan siyang nagsalita nang hindi ko inaasahan na magkakaroon siya ng ganung opinyon.

48. Hindi ah? tinaasan ko sya ng kilay.

49. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

50. Magandang Gabi!

Recent Searches

uniquebituinlumulusobgitarafaultmakapilingpagbahinglabananprogramsablenapapalibutankakayanannaghinalanamumulotfistssalitangmakikipagbabagspecializednagandahansabongsasayawinpaskopa-dayagonalyourself,pusoupuansacrificesumayawnagtitinginannakabasagcruzdingdingunosdaraankarnabalnahulogmenosmananaloclientesakintanongcassandracontinuedfiverrumuwibakantenag-eehersisyobritishlandoraildisenyoteachingsinuminnangyayarinakasakitpresidentialhimayinsino-sinonutsglobalisasyoninuulcernamulaklakpakealamanmainitmaligoitotuwang-tuwaibinubulongunidosnariyannagbakasyonnabubuhaymakahiramcallpunodinalagalaannitoiloilolumitawpaidpageantbayandaladalamalapitmagulangdurikatagangemnerharapnagyayanginfluencescuriousadecuadopinadalasharemahinognakitakumantawalletmakakakaeneksportererannalinggongafternoonniyonheartjeepneypatakbonglibertykarwahengnaiiritangkatapatgratificante,asiasponsorships,bihirangnasasakupancarspinagtagpotakbonetflixexperts,misyunerobulongpagkapasokpalangconstitutionveryamuyinlangkayinilistarenacentistasaritalondonrenaiaumiimikmamanhikaninaasahanpinangbaduybumabahapinanawanfigurepaglalabahimmaliitdisyempreaudiencenapatayoipagbilisilbinghydelbumilimatitigaslordnakakadalawtsssumingitcommunicationspondopumitasnaroondatinandiyanplanareasrobinhoodayokosahodpublishing,emocionalpangkatkahoynagkasakitngisipaparusahanschoolsumagawmagbalikmakakasahodnahihiloinakyatkumikinigsidomournedforceskakaantaysurveysrelativelypositionerlagiinagawiniwansumusunoblesspagsidlansapatosnakaririmarimabala