Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "binasa"

1. Binasa niya ang balikat, ang mga bisig.

2. Binuksan ko ito at binasa yung nakalagay.

3. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

Random Sentences

1. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

2. Gaano katagal niyang hinintay ang pakete?

3. Bye! liliko na sana ako para mag-iba ng exit.

4. Tengo dolor de oídos. (I have ear pain.)

5. Ngunit ang bata ay naging mayabang.

6. The cake is still warm from the oven.

7. Me encanta la comida picante.

8. Miguel Ángel fue un maestro de la técnica de la escultura en mármol.

9. El proceso de dar a luz requiere fortaleza y valentía por parte de la madre.

10. Paano mo pinalambot ang giniling na karne?

11. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

12. We need to get this done quickly, but not by cutting corners.

13. Good things come to those who wait

14. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

15. Pagputi ng uwak, pag-itim ng tagak.

16. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

17. Ngayon lang ako nag mahal ng ganito.

18. They clean the house on weekends.

19. Lahat ay nagpasalamat sa nagawang tulong ni Tarcila at nakiramay rin sila sa sinapit ng mga anak nito.

20. Dapat pa nating higpitan ang seguridad ng establisimyento, mungkahi naman ng manager.

21. Ngayon lamang ako nakakita ng dugo na kulay abo.

22. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

23. Pakitimpla mo ng kape ang bisita.

24. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

25. Isinalaysay niya ang pagkapasan sa krus upang iligtas lamang ni Hesus ang mga makasalanang tao sa daigdig.

26. Walang matigas na tinapay sa gutom na tao.

27. Gaano ko kadalas dapat inumin ang gamot?

28. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

29. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

30. Setiap agama memiliki tempat ibadahnya sendiri di Indonesia, seperti masjid, gereja, kuil, dan pura.

31. La realidad es que a veces no podemos controlar lo que sucede.

32. Limitations are the boundaries or constraints that restrict what one can or cannot do.

33. Wait lang ha kunin ko lang yung drinks. aniya.

34. Bakit hindi kasya ang bestida?

35. Hindi ko alam kung may pag-asa ako sa iyo, pero sana pwede ba kitang mahalin?

36. If you keep cutting corners, the quality of your work will suffer.

37. Dapat tayong mag-ingat sa sobrang pangamba dahil ito ay maaaring makaapekto sa ating kalusugan.

38. Kanino humingi ng tulong ang mga tao?

39. Nagkwento ang lolo tungkol sa multo.

40. Les impôts sont une source importante de revenus pour l'État.

41. Punung-puno ng bunga ang puno, ngunit sobrang asim naman ng laman.

42. Namnamin ang bawat minuto kasama ang iyong pamilya.

43. Arbejdsgivere søger pålidelige og punktlige medarbejdere.

44. The lightweight fabric of the dress made it perfect for summer weather.

45. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

46. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

47. A lot of noise from the construction site disturbed our peace and quiet.

48. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

49. The uncertainty surrounding the new policy has caused confusion among the employees.

50. Binabasa ng mga mag-aaral ang talambuhay ni Emilio Aguinaldo para mas maunawaan ang kasaysayan ng Pilipinas.

Recent Searches

associationbinasapadabogkikotirangantokkawawangnasabingdisenyoflooreuphorickapetillblusangpalapitgeneaabotvalleychangecapacidadesellennakaliliyonggayunpamanpagluluksanagngangalangsportskomedorhongbatang-batatienecomunesmakahirampagkuwahampaslupamakakawawanagtagisannaglipanangpaki-translatekingdomnangyarikuwentogasolinakamiaskinumutanbalediktoryankaibiganpagtataasleksiyontiktok,handaanbroughtmadungispictureslumutangmasasabiperpektingkampeonhumalomusicalesre-reviewbeachgrewempresasginawanginlovepantalongoperativossocialesumikotbangkangcombatirlas,ctricasituturopaalamnahantadrequierenbutterflypinalambotmandirigmangmasungitanongimbestsuperdomingomuchaforskelnochesikipsinungalingreboundtamadoktubredalawinkaragatanmanonoodsongsligaligmatulunginmaatimbumangonandreapupuntatabasvedputahedragonballbinabaanworkingmulighederdisyembrepatunayanconsumepagputiisamabulakbalotmayroonglimittipseachprovekumaripaspartyresttapospostcardandamingdolyarinantokmuchendvidereprodujomodernenag-replynagsisipag-uwianmaglalabing-animbukodalwaysshouldcabletipnutrientes,aumentargumagalaw-galawcallclearteamaddlcdstuffedpromotingnakaririmarimcreationsomecornerwouldspeechboxindependentlylikuranculturalinternetnapapalibutannakapagsasakaypakilagayrosarioinakalailihimmangingisdanggeneratepinagsasasabipagkakakulongmagtanghaliankapangyarihanghighestevolvedclassestoolcreatinginteligenteshumigit-kumulangpatuloysakyanjunjunnagtungomakaangalbalingsatisfactionnagbungachildrenmagulayawuminombagkus,freedomssaleshalippaslitsalatsantos