Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

60 sentences found for "over"

1. A couple of friends are coming over for dinner tonight.

2. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

3. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

4. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

5. At være ærlig over for os selv og andre er vigtigt for en sund samvittighed.

6. Danmark eksporterer mange forskellige varer til lande over hele verden.

7. Don't cry over spilt milk

8. Don't worry, it's just a storm in a teacup - it'll blow over soon.

9. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

10. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

11. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

12. Football is a popular team sport that is played all over the world.

13. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

14. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

15. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

16. Holy Week er en tid til eftertanke og refleksion over livets cyklus og død og genfødsel.

17. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

18. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

19. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

20. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

21. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

22. It ain't over till the fat lady sings

23. It's not worth getting worked up over - it's just a storm in a teacup.

24. Lazada has faced criticism over counterfeit products being sold on its platform.

25. Lazada's mobile app is popular among customers, with over 70 million downloads.

26. Musk has been involved in various controversies over his comments on social and political issues.

27. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

28. Musk has faced controversy over his management style and behavior on social media.

29. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

30. Nationalism can also lead to a sense of superiority over other nations and peoples.

31. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

32. Over-emphasis can be counterproductive and may undermine the intended message.

33. She's always creating drama over nothing - it's just a storm in a teacup.

34. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

35. Some people have a sweet tooth and prefer sweet flavors over others.

36. Teknologi er en vidtstrakt kategori, der dækker over en række forskellige områder, fra elektronik til software til maskiner og transportmidler

37. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

38. The argument was really just a storm in a teacup - it wasn't worth getting upset over.

39. The concept of money has been around for thousands of years and has evolved over time.

40. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

41. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

42. The nature of work has evolved over time, with advances in technology and changes in the economy.

43. The novel was a hefty read, with over 800 pages.

44. The pneumonia vaccine is recommended for those over the age of 65.

45. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

46. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

47. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

48. The teacher assigned a hefty amount of homework over the weekend.

49. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

50. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

51. The Tesla Model S was the first electric car to have a range of over 300 miles on a single charge.

52. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

53. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

54. The value of money can fluctuate over time due to factors such as inflation and changes in supply and demand.

55. This can be a good way to grow your wealth over time, but it also carries risk

56. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

57. TikTok has been banned in some countries over concerns about national security and censorship.

58. TikTok has faced controversy over its data privacy policies and potential security risks.

59. We sang "happy birthday" to my nephew over video chat.

60. Wedding traditions and customs continue to evolve and change over time.

Random Sentences

1. At sa kanyang maninipis na labi, na bahagyang pasok sa pagkakalapat at maputla, ay naglalaro ang isang ngiti ng kasiyahan.

2. The store offers a variety of products to suit different needs and preferences.

3. Masaya ang pakanta-kantang si Maria.

4. Paano ako pupunta sa airport?

5. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

6. Diyan ang bahay ni Mr. Marasigan.

7. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

8. Kailangan nating magsimula sa pagkakaroon ng pangarap upang magkaroon ng inspirasyon sa buhay.

9. La creatividad es fundamental para el desarrollo de ideas innovadoras.

10. Nandito ako sa mall. Trip lang, ayoko pang umuwi eh.

11. Disyembre ang paborito kong buwan.

12. Laking pagkamangha ni Aling Rosa ng makita ang anyo ng bunga nito.

13. Sa loob ng bilangguan ay doon rin niya nakilala ang isang pari, si Padre Abene

14. Nag-aral ng kasaysayan ang estudyante.

15. Kailangan mong umintindi ng kaibuturan ng kanyang pagkatao upang magkaroon kayo ng mas malalim na ugnayan.

16. Bumibili si Consuelo ng T-shirt.

17. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

18. Lumingon ang bata sa kanyang paligid, inisa-isa ang mga mukhang nakatunghay sa kanya

19. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

20. ¿Qué fecha es hoy?

21. Sa pagtulog, ang utak ay nagpapahinga at nagpaproseso ng mga impormasyon na natutunan sa buong araw.

22. Necesito ver a un médico. (I need to see a doctor.)

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. Sa harapan niya piniling magdaan.

25. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

26. At pagkauwiy humiga nang humiga at paulit-ulit na tumingin sa kawalan.

27. Walang makakibo sa mga agwador.

28. Ada berbagai jenis kucing yang ada di Indonesia, seperti kucing Persia, Siamese, dan Scottish Fold.

29. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

30. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

31. Ang kamalayan sa epekto ng teknolohiya sa lipunan ay nagbubukas ng mga pinto sa masusing pagsusuri.

32. Ngumiti siya ng malapad sabay hagikgik.

33. Nakipag bahay-bahayan kay Athena.

34. Tatanggapin ko po ang anumang kaparusahan.

35. Ada beberapa tradisi dan kepercayaan terkait kelahiran di Indonesia, seperti menjaga diri dan pola makan selama masa kehamilan.

36. Ang salitang "laganap" ay nangangahulugang malawakang kumakalat, umiiral nang malawakan

37. Kumakain ka ba ng maanghang na pagkain?

38. The song went viral on TikTok, with millions of users creating their own videos to it.

39. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

40. Tila maganda ang panahon ngayon para sa isang mahabang lakbayin.

41. En invierno, los lagos y ríos pueden congelarse, permitiendo actividades como el patinaje sobre hielo.

42. Umiiyak ang kanyang mga magulang ngunit alam nilang wala na silang magawa para sa bata.

43. Con permiso ¿Puedo pasar?

44. A couple of cups of coffee in the morning help me start my day.

45. Pahiram ng iyong earphones, gusto ko lang makinig ng musika.

46. Leonardo da Vinci también pintó La Última Cena.

47. Emphasis can be used to express emotion and convey meaning.

48. Ang Sabado de Gloria ay tahimik

49. Kinakailangan niyang kumilos, umisip ng paraan.

50. Vi kan alle være helte i vores eget liv og gøre en forskel for andre.

Similar Words

discoveredOveralloverviewgovernmentgovernorscontroversycover,

Recent Searches

overnabigladinadaananconsumehdtvdahilanatesocialenvironmentputahemakamitlaroburmamagasinpalakalakadtalentartistkawayanpoloservicespangulobarung-barongcarmentaun-taonmayabongnag-away-awayumagakumakalansingmagtiwalapagdatingyanambisyosangkaninanakapilangmahabaabanagbabalaumokaysinunodgumagalaw-galawdibdibcornerespanyangromanticismonananaghilitapatnangyaringpalamahinahong1990maluwanggulomisyunerogabimagkamalimakitakapangyarihanitsurakaraokedinaluhanmahabangnag-uwipahiramt-isayumabangsmallallergyresignationtutoringyou,bahagyakumakainkatandaansocietynagbiyahefremstilletondoiba-ibangkainpagtatanimmatalinomasayang-masayapaghamakmakatulogilalimpahahanapharpbestidaisinusuotjaneibahagidumiretsonakararaannapuputolmakapalmorelever,tabinabigyanmananaogafterdreamsimportantesnag-emailherramientaestilosperpektingiyakcover,paglingabasketbolagaw-buhayuniversitiesstringbiglangteacherpagkainismalayangtuloy-tuloypinag-usapanalingtangeksilawsteermasayangnatawaseasitegumisingtraditionalumulanbinitiwanpiecesniyonnakakuhaakolearningpagguhitsimulaindustrymagingpaskonotsectionsnakasakitlupamagigitingbrainlylibreadgangnangyarinanginginigsiyauniversitymagnifykulaynagdasaldejapostmasokkapangyahiranmuchasyakapdigitalnagmistulangrolandkinabibilanganipagamotknowoftenpagkakatayoinfusioneshimutokmatandang-matandacanteensmokingsalitangulitnakakunot-noongfriendiyonmahigitpatientsisidlansampungdieddawtaga-suportabangbinilhanmarasigansakenimulatfanskumatokgirisasahannag-isipnakikilalanghinagpis