Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "suelo"

1. Aplica abono orgánico al suelo para proporcionar nutrientes adicionales a las plantas

2. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

3. El cultivo de tomates requiere un suelo bien drenado y rico en nutrientes.

4. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

5. El maíz necesita sol y un suelo rico en nutrientes

6. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

7. La calidad del suelo es un factor clave para el éxito de los agricultores.

8. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

9. Las plantas desempeñan un papel fundamental en el ciclo del agua, absorbiéndola del suelo y liberándola a través de la transpiración.

10. Los fertilizantes orgánicos son utilizados en el cultivo ecológico para enriquecer el suelo.

11. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

12. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

Random Sentences

1. Nag-iisa man siya, hindi siya nawawalan ng pag-asa.

2. Ikinagagalak ng pamahalaan na maghatid ng tulong sa mga nangangailangan.

3. Dahan dahan kaming nag lakad. Papapunta sa may.. Sigh.

4. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

5. The bag of groceries was too hefty for the elderly woman to carry on her own.

6. Ang mga tradisyunal na parada ay isang kakaibang aspeto ng Chinese New Year.

7. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

8. A couple of pieces of chocolate are enough to satisfy my sweet tooth.

9. La labradora de mi cuñado es muy ágil y puede saltar obstáculos muy altos.

10. Det er vigtigt at huske heltenes bedrifter og lære af dem.

11. Ang mga pamilya ay nag-aayos ng mga handa at nagdadasal para sa kasaganaan sa darating na taon.

12. They are not running a marathon this month.

13. Nag-pout si Mica saka kumapit sa braso ko.

14. Einstein was awarded the Nobel Prize in Physics in 1921 for his explanation of the photoelectric effect.

15. Talaga? Sige nga ipakita mo nga saken.

16. Obvious. tawa nanaman sya ng tawa.

17. It may dull our imagination and intelligence.

18. Ang mailap na mga bagay ay kailangan paglaanan ng oras at pagsisikap upang makamit.

19. Scientific evidence suggests that global temperatures are rising due to human activity.

20. Nasa Montreal ako tuwing Enero.

21. Bumili ako ng bagong set ng kubyertos para sa aming bahay.

22. Omelettes are a popular choice for those following a low-carb or high-protein diet.

23. Ang mga magulang ay dapat maging maingat sa pagbabantay sa kanilang mga anak upang maiwasan ang paggamit ng droga.

24. Ang pagkakalugmok sa propaganda at panlilinlang ay nagpapahiwatig ng pagiging bulag sa katotohanan.

25. Hindi ko nakita ang magandang dulot ng kanilang proyekto kaya ako ay tumututol.

26. Sa panahon ngayon, napakahalaga ng mga taong bukas palad dahil sila ang nagbibigay ng pag-asa sa mga taong nangangailangan.

27. En España, la música tiene una rica historia y diversidad

28. Ilang kuwarto ho ang gusto niyo?

29. Kucing di Indonesia juga dikenal dengan sebutan "meong" atau "ngomong" karena suaranya yang unik.

30. Sumagot agad si Kuya isang ring pa lang.

31. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

32. Nag-enjoy ako sa pag-aaral ng isang bagong wika kaya nahuhumaling ako sa pag-aaral ng iba pang wika.

33. Sa Chinese New Year, ang mga tao ay naglalagay ng dekorasyon na may pulang kulay bilang simbolo ng kapalaran.

34. Ang pangalan ng tatay ko ay Honesto.

35. He served as the 45th President of the United States from 2017 to 2021.

36. We have been married for ten years.

37. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

38. The pretty lady in the movie stole the protagonist's heart.

39. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

40. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

41. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

42. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

43. Wala kang dalang payong? Kung gayon, mababasa ka ng ulan.

44. Proud ako sa kultura at tradisyon ng mga Pinoy.

45. I have a craving for a piece of cake with a cup of coffee.

46. Es teler adalah minuman dingin yang terdiri dari buah-buahan yang dicampur dengan sirup dan santan.

47. Huwag magpabaya sa pagsunod sa mga patakaran at regulasyon sa trabaho.

48. Ang kasama naming lalaki ang nag-piloto nito.

49. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

50. Napakatagal sa kanya ang pagkapuno ng mga balde ni ogor.

Similar Words

Consuelo

Recent Searches

sueloahhhhcareerpatayalwaysmagkapatidmakulongkargahanpinamalagiencuestasendingkinalilibingannakakasamadetectedworkingprinceothers,longclarafulfillmentmagtakamaskinerlasfacilitatingfencingimproveikinamataymedikalcitizendevicessmallpumuntasistemasintroducehusoikinabubuhayformamaarawjunioemphasisfitnowfulfillingpasalamatanstarredsumusunodeventsforcesserumakbayshortmahabolideasmauuposarasaritadiagnosesiniwaninfinityinagawnagreklamouniversitieskingphysicallendinginspireleukemiasummernanahimikmagpa-pictureagapresenceilihimnalugodfreeanothertonightmarketing:nahulogmostnakakasulathowevermaaaringdumiretsonatutuwamakakawawaartsbilerngumingisifurtherpalagibauli-rechargehvordevelopedpowercomunesunattendednogensindetemparaturastatusgenerationervampiresnagbiyahethemkambingmarkedthingwithoutinvesteitherasulnatupadthereforecardpagsidlancuandomaistorboawarepuedentheserightlikeneveritinagoforskeltwinklepagsalakayallowssolardiagnosticdaywaygracemoderntumahanleomagseloslutomediumprovidedherramientapalayanboyetkeepeeeehhhhincreasejosiecharitablemuchfacebooktakesydelserpulgadasinceflyincluirknowhatingsiniyasatburmamangingibigcorrientesmatarayparticipatingfueculpritresearchmagsusuotpromotingfistswonderdefinitivocarbonkinalakihanintramuroshighespadafertilizerisinalaysaytwo-partyhomecertainlazadamagtatanimmidtermunderholderfewmadenanlilimosdreamsstudentcadenamovingwalletletxviiguestsothersled