Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "after"

1. After finishing the marathon, the runner was euphoric with their achievement.

2. After months of hard work, getting a promotion left me feeling euphoric.

3. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

4. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

5. Einstein's brain was preserved for scientific study after his death in 1955.

6. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

7. I finally quit smoking after 30 years - better late than never.

8. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

9. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

10. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

11. Ok. Free ka ba after work? Favor lang sana please.

12. Online traffic to the website increased significantly after the promotional campaign.

13. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

14. Revise and edit: After you have a complete draft, it's important to go back and revise your work

15. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

16. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

17. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

18. The business started to gain momentum after a successful marketing campaign.

19. The company's profits took a hefty hit after the economic downturn.

20. The depth of grief felt after losing a loved one is immeasurable.

21. The feeling of accomplishment after completing a difficult task can be euphoric.

22. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

23. The patient was discharged from the hospital after recovering from pneumonia.

24. The political campaign gained momentum after a successful rally.

25. The project gained momentum after the team received funding.

26. The stock market gained momentum after the announcement of the new product.

27. The team lost their momentum after a player got injured.

28. The team’s momentum shifted after a key player scored a goal.

29. The traffic on social media posts spiked after the news went viral.

30. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

31. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

32. There were a lot of boxes to unpack after the move.

33. When it comes to politics, it can be tempting to bury your head in the sand and ignore what's going on - after all, ignorance is bliss.

Random Sentences

1. La paciencia nos enseña a esperar el momento adecuado.

2. Ibinigay niya ang kanyang talento at galing sa musika upang mapasaya ang marami.

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Papanhik din sana siya sa tuktok ng burol subalit naabot siya ng rumaragasang tubig-ulan na lalong nagpalalim sa dagat-dagatan.

5. Nagitla ako nang biglang may kumatok sa pinto.

6. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang harapin ang mga pagsubok at mga hadlang sa kanilang buhay.

7. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

8. Narinig ko ang hinagpis ng mga magsasaka dahil sa mababang presyo ng kanilang ani.

9. Tumayo siya tapos umalis na. umuwi na rin ako ng bahay.

10. Bien hecho.

11. Ikinuwento niya ang nangyari kay Aling Pising.

12. Beyoncé is a highly acclaimed singer, songwriter, and actress known for her powerful performances and chart-topping hits.

13. Pag-ibig na palaisipan, sa kanta na lang idaraan

14. Ito na ang kauna-unahang saging.

15. Hinde ko siya pinansin at patuloy lang sa pag kain ko.

16. Nakakatakot maglakad mag-isa sa hatinggabi sa isang hindi kilalang lugar.

17. Ginising ko si Cross, Oy gising. Umaga na.

18. Waring hindi pa handa ang kanyang puso na magmahal muli.

19. Ipaghanda mo si Lina ng Maghanda ka ng damit

20. Nous avons réservé une salle de réception pour la célébration.

21. Ang republika na itinatag niya ang unang demokratikong republika sa Asya.

22. Sa kanyang paglalakad, napadungaw siya sa isang tindahan ng kakanin at napabili ng puto.

23. There are many different types of microscopes, including optical, electron, and confocal microscopes.

24. Nang sumapit ang ika-12 ng hating gabi, nagpalit ng anyo ang kakaibang pusa.

25. Agad silang nagpunta kay Tandang Isko, ang arbularyo sa katabing bayan.

26. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

27. Dahil sa pandidiri ay nilayuan niya ito pero ang pulubi ay humabol at nagmakaawa.

28. Tinanong ng guro kung mayroon kaming mga katanungan ukol sa aralin.

29. Like a diamond in the sky.

30. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

31. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

32. Walang mangyayari satin kung hindi tayo kikilos.

33. If you're trying to get me to change my mind, you're barking up the wrong tree.

34. Matagal na yan. Hinde ko lang nabigay sayo.

35. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

36. Kakutis ni Kano ang iba pa niyang kapatid.

37. I received a lot of happy birthday messages on social media, which made me feel loved.

38. The impact of the pandemic on mental health has been immeasurable.

39. Gawa/Yari ang Tshirt sa Tsina.

40. The Ugly Duckling is a story about a little bird who doesn't fit in until he discovers he's actually a beautiful swan.

41. Gaano katagal ho kung sasakay ako ng dyipni?

42. The bird sings a beautiful melody.

43. Iginitgit ni Ogor ang bitbit na balde at kumalantog ang kanilang mga balde.

44. Ang sugal ay isang aktibidad na nasa ilalim ng panganib ng pagkakaroon ng adiksyon at mental na kalusugan.

45. Ang maliit na aso ay hinahabol ang anino ng saranggola.

46. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

47. Ang lahat ng problema.

48. Balak kong magluto ng kare-kare.

49. Eksport af tøj og beklædningsgenstande fra Danmark er også stigende.

50. Ada berbagai jenis kucing yang ada di Indonesia, seperti kucing Persia, Siamese, dan Scottish Fold.

Similar Words

afternoon

Recent Searches

aftertravelkargangmakisigbayawakbesidesmahalagaquenagsalitapangalansasabihinmakikipagsayawefficientaguanapapasayatuyongnahihilonakagawianlumulusobmakahihigitunconstitutionalbabalendgandamag-ibadaanbakitpaaralanlikodulitniyosalamangkerocuttiniklingnalasingtwo-partymaputihinagismungkahitahimikskillsoscarbankbingosang-ayonpumatolnagsuotmakauuwifrogdencorrectingprogrammingarghnagmungkahimakasamaanak-mahirapnatatakotsiemprephilanthropykuwartonagpasyapinamalagipakakatandaanmakakawawakayalupanilanaglipanangkapwaminervieisaprimerasbutinoodkarnepinagmamasdankapatawaranhouseholdsmagtatagalsoportemakainmakitanglotgumalinglitsonfurmatakotkagandahanmagnakawpagkahapotalahapag-kainanmagpagupitnaglalakadconectadosderhalagapilanapaluhasignificantranaynagtruenanlilisiktwodraft:19821980batok---kaylamig197311pmgustong00ampaskomismozooseguridadyunyouyeyyesyepyanwowwaywaguwiuposinounounaulobitiwanuliubotoytoltiptaobighanimapsyaspasirsheseesaysannakakalasingrinrefredrawpshpdapagpaamababawoutshiningnameitimsuotoueopoeksportenoneomgnyonaglalabanunnuhpaanannownotnoonohnodnganewnasmrsmgamayfireworksmasmanmagluzlosletleethroughoutkitkayjoykalayuanjoeeksperimenteringhojas