Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "after"

1. After finishing the marathon, the runner was euphoric with their achievement.

2. After months of hard work, getting a promotion left me feeling euphoric.

3. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

4. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

5. Einstein's brain was preserved for scientific study after his death in 1955.

6. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

7. I finally quit smoking after 30 years - better late than never.

8. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

9. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

10. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

11. Ok. Free ka ba after work? Favor lang sana please.

12. Online traffic to the website increased significantly after the promotional campaign.

13. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

14. Revise and edit: After you have a complete draft, it's important to go back and revise your work

15. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

16. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

17. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

18. The business started to gain momentum after a successful marketing campaign.

19. The company's profits took a hefty hit after the economic downturn.

20. The depth of grief felt after losing a loved one is immeasurable.

21. The feeling of accomplishment after completing a difficult task can be euphoric.

22. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

23. The patient was discharged from the hospital after recovering from pneumonia.

24. The political campaign gained momentum after a successful rally.

25. The project gained momentum after the team received funding.

26. The stock market gained momentum after the announcement of the new product.

27. The team lost their momentum after a player got injured.

28. The team’s momentum shifted after a key player scored a goal.

29. The traffic on social media posts spiked after the news went viral.

30. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

31. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

32. There were a lot of boxes to unpack after the move.

33. When it comes to politics, it can be tempting to bury your head in the sand and ignore what's going on - after all, ignorance is bliss.

Random Sentences

1. Sa tuwing nagkakasama kami, nadarama ko ang walang hanggang pagmamahal ng aking kabiyak.

2. ¿Qué fecha es hoy?

3. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

4. Ikaw na nga lang, hindi pa ako nagugutom eh.

5. Nagbigay ng pahayag ang alkalde ukol kay Maria tungkol sa mga plano para sa lungsod.

6. Laughter is the best medicine.

7. How I wonder what you are.

8. A caballo regalado no se le mira el dentado.

9. He is not having a conversation with his friend now.

10. John Adams, the second president of the United States, served from 1797 to 1801.

11. Hinanap niya ang dalaga sa buong kagubatan ngunit hindi niya nakita.

12. En invierno, los árboles pierden sus hojas y se vuelven caducos.

13. Tumayo siya tapos nagmadaling pumunta sa cr

14. Nalungkot ang Buto nang dumilim na ang paligid.

15. Ilang kuwarto ho ang gusto niyo?

16. Bakit hindi? ang natigilang pagtatanong ni Mariang Maganda habang pinagmamasdan ang malungkot na mukha ng prinsipeng kanyang iniibig.

17. Cryptocurrency can be used for both legal and illegal transactions.

18. Maraming taong nakakalimot sa kababawan ng buhay dahil sa materyal na bagay.

19. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

20. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

21. Matayog ang pangarap ni Juan.

22. Yey! Thank you Jacky! The best ka talaga!

23. Maya-maya lang, nagreply agad siya.

24. Hindi ako usually ganto, pero sana pwede ba kita makilala?

25. Tumawag ang pamilya ng albularyo upang gumaling ang kanilang kamag-anak mula sa misteryosong sakit.

26. Ano ang ginawa mo noong Sabado?

27. Ano ang ginawa ni Tess noong Marso?

28. What goes around, comes around.

29. Puwede ba tayong magpa-picture na magkasama?

30. Nakatulog ako sa harap ng telebisyon at nagitla ako nang biglang nagtaas ang boses ng mga artista sa palabas.

31. We were stuck in traffic for so long that we missed the beginning of the concert.

32. Natagpuan niya ang singsing matapos niyang salatin ang ilalim ng sofa.

33. Ah eh... okay. yun na lang nasabi ko.

34. Einstein was a pacifist and spoke out against war and violence throughout his life.

35. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

36. Ang presidente ng Pilipinas ay nagpabot na ng ayuda sa mga mahihirap.

37. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

38. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

39. Eine klare Gewissensentscheidung kann uns helfen, unser Leben in Einklang mit unseren Überzeugungen zu leben.

40. Internal Audit po. simpleng sagot ko.

41. Bumili si Ryan ng pantalon sa palengke.

42. Ang mumura ng bilihin sa divisoria.

43. Las serpientes son animales de sangre fría, lo que significa que dependen del ambiente para regular su temperatura corporal.

44. The officer issued a traffic ticket for speeding.

45. "Dogs come into our lives to teach us about love and loyalty."

46. Les personnes âgées peuvent être victimes d'abus ou de négligence de la part de leur entourage.

47. Hinugot niya ang kanyang bag sa ilalim ng mesa.

48. Les personnes âgées ont souvent des problèmes de santé chroniques qui nécessitent une attention particulière.

49. Wala siyang dalang payong, samakatuwid, nabasa siya ng ulan.

50. Hindi malinis ang mga tsinelas ni Lori.

Similar Words

afternoon

Recent Searches

afterdi-kalayuaneksport,pinabilimangiyak-ngiyakstaylumayonatinmamimissditopagamutanpaksaboksingmapagkalingasoonnapasigawusegayundincakehayopjigsliablemaintainnicoskillskarnabalnetopalibhasaisinaranyanrosariolungsoddatimarinigretirarutak-biya1990nakakaalamfullcompletamenteworrynamumutlamightdinidumikitbundokitsnaunaguroyeardaraankumakapitbenefitspilipinodumarayoairplanesnecesariopanginoonmakasamapadabogandaminglamesahumpaywalamovingpagkagisingadoptedunokamaopagkakamalikayoumutangownlaslossniyangflymaskinerbahagyangbahagyaeffortsmallcontinuedincrediblesiramagsalitaquenagmasid-masidiyanpalikuranswimmingissuesvoresandrewnumerososvegasvidenskabcellphonevidenskabenwidespreadpalusotpanitikanmakapaghilamossocietytunaykumpleto1935yumuyukomisteryotheirpanlolokomaaamongpunong-punoklaseanimoyhabangkilalaisinalangundeniablekagandahanphilosophyuniversitiesnakabluepagtangisnewleadcoachingbinibiyayaanexistyakapheldlungkotlendmasyadosoportegagamalapitpangitpagkikitapataynagsisikainviolencecompartenbilibkapeyumakapmotionpropesorpagkakatayobefolkningenpakialamdali-daliiniintayhinanappoloprivatemalayangresultanahulaanpaskokumalantogfindhapag-kainantingingtrasciendesahignakakatandalottobirthdaypinataypapapuntapagkalipasserioushimutokbentangpatialwaysgusting-gustongayonnagpakilalaekonomiyasaidtelefonerdecreasednilolokoaumentardoktorgabikantapagkalapitwednesdayincreasesgregorianonapakabutipag-aapuhaphinagissampungumalistonightdrawing