Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "helped"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

3. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

4. Einstein's work also helped to establish the field of quantum mechanics.

5. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

6. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

7. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

8. Her charitable spirit was evident in the way she helped her neighbors during tough times.

9. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

10. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

11. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

12. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

13. Scientific data has helped to shape policies related to public health and safety.

14. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

15. The cough syrup helped to alleviate the symptoms of pneumonia.

16. The medication helped to lower her high blood pressure and prevent complications.

17. The pretty lady at the store helped me find the product I was looking for.

18. The victim's testimony helped to identify the culprit in the assault case.

19. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

20. These films helped to introduce martial arts to a global audience and made Lee a household name

21. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

22. We sang "happy birthday" to my grandma and helped her blow out the candles.

Random Sentences

1. Ano ang nasa ilalim ng baul?

2. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

3. Sa wakas sinabi mo rin. aniya.

4. Nag-aaral siya sa Seasite bawat araw.

5. Naawa naman ang pamilya kay Damaso, kaya doon na pinatira sa bahay nila ito.

6. Would you like a slice of cake?

7. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

8. Marami pa siyang mga pangarap sa buhay at kailangan ko pa po siya.

9. The company's CEO announced plans to acquire more assets in the coming years.

10. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

11. Kung gusto may paraan, kung ayaw may dahilan.

12. Pasensya na, masama ang pakiramdam ko.

13. "Ang taong nagigipit, sa patalim kumakapit" ay isang bukambibig na nagpapakita ng kakayahan ng tao na gumawa ng mapanganib na mga hakbang kapag sila ay nasa kritikal na sitwasyon.

14. Sinabi ng guro na mayroong eksaminasyon sa susunod na linggo.

15. Sinabi naman ni Apollo ang mga dapat gawin.

16. Kapag dapit-hapon, masarap mag-jogging dahil mas malamig na ang panahon.

17. L'auto-évaluation régulière et la mise à jour de ses objectifs peuvent également aider à maintenir une motivation constante.

18. Isinawak niya ang kamay, pinagkiskis ang mga palad at pagkaraa'y naghilamos.

19. Lahat ay nakatingin sa kanya.

20. Magsisine kami sa makalawa ng hapon.

21. El equipo de recolección mecánico es muy eficiente para cosechar grandes extensiones de tierra.

22. Pininturahan nila ang bahay ng puti upang magmukhang maaliwalas.

23. ¿Quieres que le agregue un poco de picante a tu comida?

24. The writer published a series of articles exploring the topic of climate change.

25. Mahal ang mga bilihin sa Singapore.

26. Tengo escalofríos. (I have chills.)

27. Ano pa ba ang ibinubulong mo?

28. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

29. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

30. I'm going through a lot of stress at work, but I'm just trying to hang in there.

31. Ang pagkakaroon ng kinikilingan sa kabila ng malinaw na ebidensya ay nagpapahiwatig ng pagiging bulag sa katotohanan.

32. Me siento caliente. (I feel hot.)

33. Wag kang mag-alala.

34. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

35. Sa takip-silim, maaari kang mapakali at magpakalma matapos ang isang mahabang araw.

36. I love you, Athena. Sweet dreams.

37. At blive kvinde kan også være en tid med forvirring og usikkerhed.

38. Sa kanyang masamang gawain, nai-record ng CCTV kung paano siya na-suway sa patakaran ng paaralan.

39. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

40. May nakita umano ang mga residente na kakaibang liwanag sa kalangitan.

41. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

42. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

43. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

44. Hindi malinis ang mga tsinelas ni Lori.

45. Ano ang nasa bulsa ng bag niya?

46.

47. Iginitgit din niya ang sa kanya, bahagya nga lamang at takot na paggitgit.

48. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

49. Magandang umaga Mrs. Cruz

50. Ang kamalayan sa mga isyu ng karapatang pantao ay nagpapabukas ng pinto sa pagtugon sa mga pangangailangan ng mga mahihirap.

Recent Searches

invitationhelpeddalapalapitmagbabalamahabangtamisfulfillingadicionalesmag-ingatkomunikasyonattacktabihanpagkabiglagulatcosechar,pagsisisikumembut-kembotgupitumupokahoystocksdrewtumabatutubuinnakakapuntanagbiyahepaksanapakagandawithoutnatanggapmini-helicoptermasayang-masayakailankasaganaanmangingisdascottishhinanapenchantedgalingownfrednaglarostreetusaligalabornagpakunotailmentsdecreasecompletamentetumindignag-aalalangcarlouniquepoliticsteleviewingmagpapaikotnatutulogmagkaibapuntahanmamuhayglorialumulusobmailapbituinkumukulohulingnapilingpagbahingbenefitsapatnapunapapansinnaminsaadmarahangmakilalaeffektivtsarilingbeerspellingyukonapawiakalaburdenriegalutuingranadaaccessusuariopilitperoeneropassivenahigalandlineideologiesgenerationsandroidliveshawaknaabutanusurerobingocrecerbigkisnapaplastikanandreanakapikit1940gumantiabonoikinakagalititemsrecentkinamumuhiansupplyhabitawtoritadongmabagalbirobanyosahigpaki-ulitnakaka-intobaccopagkakapagsalitapahingatumaggaphumblenakaimbakcafeteriaperpektopagtawakasapirinkalimutankumaennaabotsapatosnasabingeksenamamayaestadostelebisyonrenepinabayaantiyakpagtutoltaingabungadfacesundalomaglalakadtubigkutodnatulaktunaypakibigaymababasag-ulomanwaringdilimpitonatalowasakbisikletahinukayjunjunpreviouslyhalamanmasasalubongrosellemeetingbutilsapatilangnicepaga-alalanamamsyalmakakamakuharolandvetomakatiginanggownnahihirapannagtataemarahilmagworklumusobpanunuksoexplaingaphinamonkahaponlumbaynenaemocionesnauntog