Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "helped"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

3. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

4. Einstein's work also helped to establish the field of quantum mechanics.

5. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

6. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

7. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

8. Her charitable spirit was evident in the way she helped her neighbors during tough times.

9. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

10. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

11. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

12. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

13. Scientific data has helped to shape policies related to public health and safety.

14. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

15. The cough syrup helped to alleviate the symptoms of pneumonia.

16. The medication helped to lower her high blood pressure and prevent complications.

17. The pretty lady at the store helped me find the product I was looking for.

18. The victim's testimony helped to identify the culprit in the assault case.

19. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

20. These films helped to introduce martial arts to a global audience and made Lee a household name

21. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

22. We sang "happy birthday" to my grandma and helped her blow out the candles.

Random Sentences

1. He has been practicing the guitar for three hours.

2. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

3. Bumili ako ng prutas sa Berkeley Bowl.

4. Mangiyak-ngiyak siya.

5. Nag-aapuhap siya ng dispensa mula sa simbahan para sa kanyang mga nagawang kasalanan.

6. The team’s momentum shifted after a key player scored a goal.

7. Ang alon sa karagatan ay malakas ngayon dahil sa bagyong dumaan.

8. Ano ang binibili namin sa Vasques?

9. pagkaraan ng kargang iyon ay uuwi na siya.

10. Ok ka lang ba?

11. Nagsine kami kamakalawa ng hapon.

12. His charitable nature inspired others to volunteer at the local shelter.

13. The stuntman performed a risky jump from one building to another.

14. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

15. All these years, I have been blessed with the love and support of my family and friends.

16. Nagsimula na akong maghanap ng mga magagandang lugar upang dalhin ang aking nililigawan sa isang romantic date.

17. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

18. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

19. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

20. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

21. The wedding reception is a celebration that usually follows the wedding ceremony.

22. Weddings are typically celebrated with family and friends.

23. Ok ka lang? tanong niya bigla.

24. Pinag-aaralan ng mga mag-aaral ang talambuhay ni Ramon Magsaysay bilang isang "Man of the Masses."

25. Sikat ang mga Pinoy vloggers dahil sa kanilang creativity at humor.

26. Bigla nya akong binato ng unan, H-hoy! Magtigil ka nga!

27. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

28. The love that a mother has for her child is immeasurable.

29. Saan ho ba ang papuntang Manila Hotel?

30. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

31. The feeling of frustration can lead to stress and negative emotions.

32. Les neuroscientifiques étudient le fonctionnement du cerveau et du système nerveux.

33. Gusto mo bang sumama.

34. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

35. Araw-araw, nagsasanay si Carlos Yulo ng ilang oras upang mahasa ang kanyang mga skills.

36. Danske virksomheder, der eksporterer varer til USA, har en betydelig indvirkning på den amerikanske økonomi.

37. Receiving recognition for hard work can create a sense of euphoria and pride.

38. Ang buhay at mga akda ni Rizal ay patuloy na pinag-aaralan at pinag-aaralan ng mga estudyante at mga historyador sa buong mundo.

39. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

40. ¿Cual es tu pasatiempo?

41. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

42. Kitang-kita sa muka ng ina ang pagtataka dahil may dalang basket na puno ng mga gulay at prutas.

43. Makalipas ang siyam na buwan, isinilang ang isang napakalusog na batang babae.

44. Matutulog ako mamayang alas-dose.

45. Sa pagpanhik ng matanda sa burol ay bumuhos ang malakas na ulan, at yumanig ang lupa.

46. Lack of progress or slow progress towards a goal can also be a source of frustration.

47. Emphasis can be used to create a memorable and impactful message.

48. Masyadong mababaw ang tubig sa tabing-dagat.

49. Ilang taon ang lumipas at hindi pa rin nakikita ang gong.

50. Me encanta pasar tiempo con mis amigos jugando al fútbol.

Recent Searches

helpedangkopnagtagalsorrymasdanpagtutolpagsayadkalalakihanbotopakisabiknowledgeformsnapapalibutanfuncionesnakabulagtangpakaininnakangisinagmumukhadisenyongsoonmaliitkulaynanlilimahidnagsulputanmasaksihanbehindnaibibigayheresapatossinonginiinomlightsbiroeskwelahangustopayinteligentesstatingmagkasinggandaroquedahan-dahanpulongipinamilikinamumuhiande-dekorasyonmagsasalitabillpinalitankaguluhananaksumalakaysaktanchecksrespektivenagtakawatawatlahatiniintayhalatanghanapbuhaypinabayaanturismoproducesasanakikini-kinitatiyaktablemakulitnakalagaynanalonakatuonmatandang-matandagoodhitsurabibigmulisangkahongnanunurikatagalanhastadependpdataun-taonmaliwanagtoolmagigitingexistsoundkinalakihanniligawansourceslumulusobsulyaprebolusyonreplacedmapabiocombustiblestalenakapasabesesganyanmarilouiligtasnapakatakaweffektivnakahughikinglondonaplicacioneseksport,kagandahagikinamataydreamespecializadaspasaherodakilangsoporteselebrasyongasbarongpasalamatanjuniocallerpeepdefinitivomedievalfionaespadasunud-sunodsagotmaaamongbanlagkaninahumalakhakentertainmentpinisilaniyanangahastinungoginaganapdepartmentnagliliyabnalungkotmayorlitobusymasseskailanrailpinagkasundotumahanbayaningprimeroskasaysayanginooreloprovidedmodernrestawranmalambingeffortsmagbubukidtinderaprogramming,ipapahingapagkapitascharismatictinayiskogumigisingnagdadasalescuelasgloriapaliparinnasisiyahantherapeuticstsinainatakevictoriamaghahandainferioresamonagbibiroartistsaggressionnanlalamignakakapuntapamasahenapakasipagsatisfactionbahalapepenutrientesdaysikre,kuwartopinangalanankaraokeyung