Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "helped"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

3. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

4. Einstein's work also helped to establish the field of quantum mechanics.

5. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

6. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

7. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

8. Her charitable spirit was evident in the way she helped her neighbors during tough times.

9. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

10. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

11. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

12. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

13. Scientific data has helped to shape policies related to public health and safety.

14. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

15. The cough syrup helped to alleviate the symptoms of pneumonia.

16. The medication helped to lower her high blood pressure and prevent complications.

17. The pretty lady at the store helped me find the product I was looking for.

18. The victim's testimony helped to identify the culprit in the assault case.

19. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

20. These films helped to introduce martial arts to a global audience and made Lee a household name

21. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

22. We sang "happy birthday" to my grandma and helped her blow out the candles.

Random Sentences

1. The students are not studying for their exams now.

2. The early bird catches the worm.

3. Sa condo ko. nakangiti niya pang sagot.

4. Ano ang gusto mo, sinigang o adobo?

5. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

6. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

7. Bumaba ako sa basement ng bahay at nagitla ako nang biglang mag-on ang ilaw.

8. Elektronik kan hjælpe med at forbedre sundhedspleje og medicinsk behandling.

9. Inakalang magaling na siya sa sakit, pero bumalik ang mga sintomas.

10. Ang paglapastangan sa kalikasan ay nagdudulot ng malalang epekto sa ating kapaligiran.

11. Sige.. pupunta tayo sa Jeju Island next March 26..

12. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

13. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

14. Sa bawat hampas ng alon, tila naririnig ko ang panaghoy ng mga nawawala sa dagat.

15. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

16. Sweet foods are often associated with desserts, such as cakes and pastries.

17. Nagdala si Butch ng laruan para sa bata.

18. Les enseignants peuvent enseigner différentes matières telles que les sciences, les mathématiques, la littérature, etc.

19. Omelettes are a popular choice for those following a low-carb or high-protein diet.

20. Malapit na naman ang pasko.

21. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

22. Nakapagreklamo na ako sa pakete ko.

23. Sa loob ng maraming taon, pinaunlad niya ang kanyang abilidad sa pagsasalita ng iba't ibang wika.

24. La conciencia nos ayuda a ser responsables de nuestras acciones y decisiones.

25. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

26. Ang ganda ng sapatos ni Junjun.

27. Vi kan alle være helte i vores eget liv og gøre en forskel for andre.

28. This house is for sale.

29. Las personas pobres son más vulnerables a la violencia y la delincuencia.

30. Ang malalakas na tama ng kidlat ay binulabog ang langit at nagdulot ng takot sa mga tao.

31. Nagpasensiya na lang si Aling Rosa, napagsilbihan naman siya kahit paano ng anak.

32. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

33. Nakalimutan ko na ang pakiramdam ng hindi paghahanda sa agaw-buhay na pag-ibig.

34. Tengo que tener paciencia para lograr mi objetivo.

35. Bumili ako niyan para kay Rosa.

36. Naku, wala ka naming gagawin sa Davao.

37. Anong kulay ang gusto ni Andy?

38. Si Mabini ay nagtrabaho bilang abogado bago naging bahagi ng rebolusyon.

39. Nang umibig siya sa taga-lupang si Ramon, ang kanyang pagka-diwata'y tinalikdan niyang lubos upang mamuhay bilang ganap na tao.

40. Ang mga Pinoy ay likas na masipag at maabilidad sa anumang trabaho.

41.

42. Sigurado ka ba dyan, Kenji? tanong ng dad ni Athena

43. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

44. Si Lolo Pedro ay pinagpalaluan ng kanyang mga apo dahil sa kanyang mga kwento at payo.

45. Hindi dapat nating pabayaan ang ating mga responsibilidad sa buhay, samakatuwid.

46. They analyzed web traffic patterns to improve the site's user experience.

47. Television also allowed for the creation of a new form of entertainment, the television show

48. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

49. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

50. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

Recent Searches

helpedpa-dayagonalnapakalakasmisyunerosharmaineibinaonkaybilisculturasdavaodelebeintethanksgivingkatagangganangkanya-kanyangsingaporenakatitiganginispagtataposnapakasinungalingpinanawan1929formaleksiyoninalalayanpocapangalananhalu-halotiprestawannapapahintomatipunopriestmurang-muracarsbasurapamilihang-bayantalinopinakamagalingmaipantawid-gutomnakakapamasyalromeroboynapangitimadalingkawili-wilikinatatalungkuanggospelmagalingsino-sinomakapangyarihangspiritualadgangkitabinuksanmagbakasyont-isatiniotsinaumiimikkainispahahanapkakayanangsiyang-siyaibinibigaynaantigtsonggoexplainbestfriendbrasopokerkalawakaninstrumentalglobenagkakatipun-tiponkeepkasayawboteedukasyonpalapagtruesinapakputinge-booksabalaangkingkingdomimpactednaglabakakauntogmestmaghatinggabiaayusinsulyapsumarapflykingpearlgranorasbaranggaygeologi,kasingpuedenahigaboracayvirksomhedermaghihintayeverydancenapakatagalsusundomarahaskinainnakinignyannagmadaliamuyinsumubopandidirisinulidnapakatakawtulangtsssnakabaonnakakatawatabingangelaattorneyescuelasmagdamagantonetteumiibigmadamipagkabiglaspansmagpakaraminaroonmasaholinvitationmahiwagangnakakapuntabinawideviceswowguidancemaaringenviarmenunaabotgumuglongtungawdeliciosapinangalanansamang-paladakalaingleadingyourifugaonagkapilatnahintakutanumiiyaksayangkaninangmakatayokoronabayadkaninibinilinakahainsalarinpanatagaywangusalibabainilalabastinigumiinomkamaooperahanyuncolorsabadongbiocombustiblesconsistmaibigaymaipapamanamatabangnegosyantelockedanthonyhugismesanakapagproposewithoutpinag-usapanlumakiipinauutang