Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "helped"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

3. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

4. Einstein's work also helped to establish the field of quantum mechanics.

5. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

6. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

7. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

8. Her charitable spirit was evident in the way she helped her neighbors during tough times.

9. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

10. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

11. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

12. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

13. Scientific data has helped to shape policies related to public health and safety.

14. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

15. The cough syrup helped to alleviate the symptoms of pneumonia.

16. The medication helped to lower her high blood pressure and prevent complications.

17. The pretty lady at the store helped me find the product I was looking for.

18. The victim's testimony helped to identify the culprit in the assault case.

19. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

20. These films helped to introduce martial arts to a global audience and made Lee a household name

21. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

22. We sang "happy birthday" to my grandma and helped her blow out the candles.

Random Sentences

1. Emphasis can be used to create a sense of drama or suspense.

2. Climbing without proper equipment is incredibly risky and dangerous.

3. Kings may wield absolute or constitutional power depending on their country's system of government.

4. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

5. Maghilamos ka muna!

6.

7. Nagitla ako nang biglang nag-ring ang telepono ng madaling-araw.

8. Pinaniniwalaang ang albularyo ay may kaalaman sa lihim na karunungan ng kagubatan.

9. Controla las plagas y enfermedades

10. La robe de mariée est magnifique.

11. Saan ka kumuha ng ipinamili mo niyan, Nanay?

12. Hindi maganda na maging sobrang matakot sa buhay dahil sa agam-agam.

13. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

14. Sa kaibuturan ng aking damdamin, mahal ko siya.

15. Muling nabuo ang kanilang pamilya.

16. Investing can be a long-term strategy for building wealth and achieving financial goals.

17. Sa panghihiyang ginawa ni Kablan, gumanti ang pobreng matanda.

18. Ano ho ang nararamdaman niyo?

19. Dogs can develop strong bonds with their owners and become an important part of the family.

20. Ang mga marahas na eksena sa mga pelikula ay maaaring magkaruon ng masamang impluwensya sa mga manonood.

21. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

22. Bakit wala ka bang bestfriend?

23. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

24. The decision to release the product early was a risky but ultimately successful strategy.

25. Ang produktong ito ay may mataas na kalidad, samakatuwid, marami ang bumibili nito.

26. The dancers are not rehearsing for their performance tonight.

27. The company burned bridges with its customers by providing poor service and low-quality products.

28. En algunos países, el Día de San Valentín se celebra como el Día de la Amistad y el Amor.

29. Nang matanggap ko ang taos-pusong paghingi ng tawad, ang aking galit ay napawi at nagkaroon kami ng pagkakasunduan.

30. Pinili kong magtrabaho mula sa bahay upang makasama ang aking mga anak, bagkus may mga oras na rin na kailangan akong pumasok sa opisina.

31. Når man bliver kvinde, er det vigtigt at have en sund livsstil og pleje sit helbred.

32. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

33. Ang pagkakaroon ng sapat na kaalaman at impormasyon ay nagpapawi ng mga agam-agam at kawalang-kasiguruhan.

34. Tumugtog si Jemi ng piyano kahapon.

35. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

36. Det er vigtigt at have relevant erfaring, når man søger en ny jobposition.

37. Ow, sorry nagising ata kita. aniya.

38. La película que vimos anoche fue una obra sublime del cine de autor.

39. Ingatan mo ang cellphone na yan.

40. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

41. Tumindig ang pulis.

42. The stockbroker warned his client about investing in risky assets.

43. Ikinagagalak kong makita ang pag-unlad mo sa buhay.

44. Napakalakas ng bagyong tumama sa kanilang bayan.

45. Las hierbas de té, como la manzanilla y la melisa, son excelentes para calmar los nervios.

46. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

47. Nagsimula ang kanilang kwento sa isang takipsilim.

48. Ano ang kulay ng notebook mo?

49. Dalawampu't walong taong gulang si Paula.

50. Viruses are small, infectious agents that can infect cells and cause diseases.

Recent Searches

sanayhelpedmayabonglipatpasasaanmarchantsumasaliwkatolikoe-commerce,bantulotbanlagpauwidalawangsonidokingdompamimilhingmalikotbinanggadeletingpublicationstartedinsteadtabapatrickpointnegativemaratingkontratanakalipassocialesellmakipagtalodibisyonnalulungkotkinukuyommarurusingpagkaawaumiisodtuwidkapangyarihanakinuugod-ugodmagsusuotsandalinghumigaatentonalasingintindihinngumiwikasinggandahalamangrankinuhanapahintoarawoktubrefilipinamatakawanomaidlumilipadmasasayatraditionalguronabalitaandiscoveredtulalatelebisyonpapagalitannanakawanenterbusloaninotrentanamuhayricoeksportenlibagitemsnagwo-workneedmoremartialcongratstrasciendemakakakainsimpelultimatelyantibioticskontingstevemisacolourkalahatingekonomiyakumirotencompassescellphoneawareemocionesafterbayabaslungsodtigrebilibidlumalakimaskarabinulongdeterminasyonnagtaposbyggetmagtigilkongresolumuwasdisfrutarkasintahanumiinomnagtataasnapaiyaknakatiratatawagerlindamagkaibiganmovingglobalmagtakadoble-karanaispinagmamalakipagpapakalatregularniyanggagamitinhumalakhakpamburaadvertising,nakapagngangalitmakikitainitedukasyonmirakusinerotumutubomahuhusaynaiyakpaglisanliv,pagongkesobihirangberegningerpaidmanahimikpananglawpag-alaganabiglakastilaniyopakilagayskillspaliparinsumasayawhanginbisikletainspireinfusioneshinintaybopolstagalincidencetuvoorganizeinakyatcarriessapotnanayhulihanutilizagrammarhinogtinioayokobulakbilimainitbranchmaisdeterioratefar-reachingtaingabayawakvehiclesmakaratingnahuliabalasukateventslutoisipbusiness,