Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "marketing:"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

3. Emphasis is often used in advertising and marketing to draw attention to products or services.

4. L'intelligence artificielle peut aider à prédire les comportements des consommateurs et à améliorer les stratégies de marketing.

5. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

6. The business started to gain momentum after a successful marketing campaign.

7. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

8. Twitter is also used by businesses and brands for marketing, customer engagement, and brand promotion.

Random Sentences

1. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

2. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

3. Research and analysis are important factors to consider when making investment decisions.

4. Para sa kaniya, mas masarap magbasa kapag nag-iisa.

5. The acquired assets will be a valuable addition to the company's portfolio.

6. Nahuli na nang mga pulis ang mga nagtutulak ng illegal na droga sa kanilang lugar.

7. Gusto ko ang mga bahaging puno ng aksiyon.

8. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan.

9. Ang kanyang galit ay parang nagbabaga, handang sumiklab anumang oras.

10. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

11. They admired the beautiful sunset from the beach.

12. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

13. The weather was bad, and therefore the game was cancelled.

14. Inalok niya akong sumama sa kanyang outing, datapwat may iba akong plano para sa araw na iyon.

15. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

16. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

17. Sa aking kasintahan, natatanaw ko ang pagmamahal na umaapaw sa kanyang mga mata.

18. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

19. In 2010, LeBron made a highly publicized move to the Miami Heat in a televised event called "The Decision."

20. Ano ang gusto mong gawin kapag walang pasok?

21. Aquaman has superhuman strength and the ability to communicate with marine life.

22. Dahil sa kanyang matapang na pagtindig, naligtas niya ang mga pasahero sa agaw-buhay na sitwasyon.

23. Claro que puedo acompañarte al concierto, me encantaría.

24. Sasagot na sana ako ng 'oo' ng...

25. A couple of lovebirds were seen walking hand-in-hand in the park.

26. Scissors are commonly used for cutting paper, fabric, and other materials.

27. Mas masarap ang pulotgata kapag inilagay sa ibabaw ng bibingka.

28. Scissors should be handled with care to avoid injuries and kept out of reach of children.

29. Mas magaling siya kaysa sa kanya.

30. Huwag mong hiramin ang aking payong dahil umuulan pa rin.

31. Hinawakan ni Jigs yung kanang kamay ni Athena.

32. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

33. Holy Week er en tid til eftertanke og refleksion over livets cyklus og død og genfødsel.

34. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

35. Meron ho ba kayong mainit na kalamansi juice?

36. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

37. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

38. Nakaramdam siya ng pagkainis.

39. Television has a rich history, and its impact on society is far-reaching and complex

40. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

41. Ano ang gusto mong panghimagas?

42. Kay hapdi ng kanyang batok at balikat.

43. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

44. Aba'y lintek na babaeng ito! Ang langis mo! Paano na ako magugustuhan ni Pedro nyan! ani ni Ipong sabay hawi ng buhok.

45. Nagbabakasyon ako tuwing Abril.

46. Tengo escalofríos. (I have chills.)

47. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

48. Sa ganang iyo, mas epektibo ba ang online classes kaysa sa face-to-face na pagtuturo?

49. One man, one word ka ba? Ang tipid mong sumagot eh!

50. Madilim ang kweba na kanilang pinasok.

Recent Searches

basketbolmarketing:avanceredemariebirdspalapagprobinsyaangkopeleksyonsagotkasimaghatinggabisampaguitapantalonggarbansosmagisipsugatangsangahawakhinanakitkastilangpag-uwibarongtelephoneginoongdescargarcrecernamilipitkoreaumuporeorganizingbilanginthroatmatesapa-dayagonalsalespromotelenguajeangelaisinumpagymltodahilkumatoktamafatherkapainsumisidnagisingfe-facebookpagodpagtutolbinataktanodgraphicfauxlarosawainantaytsakaplasalandepag-isipanestarrabekadaratingmasseskayreplacedbotobusoggeneasinmulachavithumanocommissionmagpunta1980judicialstaplesearchjoymuchasdidingenforcingjeromeideyaumiinitmapuputiuncheckedboteaddingtypesaffectsetsmangawarebroadcastingseparationbumabaisinalangrepresentedlibaghapdicomputereleftimagingplanrestgrabenakaupopagtinginbayabasgawinikinasasabikpinyamedicalpag-aaralangtumunogibonfatalmagdamaganasimbwahahahahahanegrosvivahigantehoykawalayawilawklasengmalayangcarmenmetodeleadnagpagawaproductssiguronawalananimoycultivapiecesprovidedproyektobagyongprocessmadungisspecializedkababaihanpalengkewarinamumuongulanmagalingmabigyanfurymisageneratedjunjunrangecomunicarsecertainestablishedtiyanapaplastikannanghahapdivirksomheder,nagliwanagiwinasiwasninyonaglakadgagawinmaglalarokonsultasyononenariningkonsentrasyonnakatunghayrevolucionadoadvertising,nageenglishmedidahalaganagpaalamnagpalalimtumahimikhitsuranagdabogsasayawintinaasanhealthierdaramdaminpangangatawankapasyahankanikanilanguugud-ugodnakaraanmagkasabay