Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "divided"

1. Congress is divided into two chambers: the Senate and the House of Representatives

2. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

3. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

4. The basketball court is divided into two halves, with each team playing offense and defense alternately.

5. The football field is divided into two halves, with each team playing offense and defense alternately.

6. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

7. The United States has a system of federalism, where power is divided between the national government and the individual states

8. The United States is a federal republic, meaning that power is divided between the national government and the individual states

Random Sentences

1. Itinago ko ang mga sulat para sa inyo.

2. Bawat eskwelahan ay may kanya kanyang alituntunin.

3. Nanalo si Ton Ton bilang presidente ng kanilang paaralan.

4. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

5. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

6. Sabi mo eh! Sige balik na ako dun.

7. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

8. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

9. He is not watching a movie tonight.

10. People can also borrow money through loans, credit cards, and other forms of debt.

11. Sa tagal at hirap na dinanas ng binata sa paghahanap sa dalaga, nagalit siya.

12. Sa mga perya, naglipana ang mga tao na naghahanap ng libangan.

13. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

14. The acquired assets included a portfolio of real estate properties.

15. Les robots dotés d'intelligence artificielle peuvent effectuer des tâches répétitives et dangereuses pour les humains.

16. Sya ngayon ay isa nang ganap na doktor.

17.

18. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

19. La foto en Instagram está llamando la atención de muchos seguidores.

20. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

21. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

22. Hindi niya alam kung anong uri ang halamang iyon.

23. Ano ang gustong orderin ni Maria?

24. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

25. Nang mawalan ng preno ang sasakyan, aksidente niyang nabangga ang poste sa tabi ng kalsada.

26. Wer nicht wagt, der nicht gewinnt.

27. Lasingero ang tawag sa taong laging nag-iinom ng alak.

28. Pagkatapos ng misa, nagbigay ang pari ng mga panalangin para sa mga kaluluwa sa purgatoryo.

29. If you keep cutting corners, the quality of your work will suffer.

30. Ang mga karapatan ng mga anak-pawis ay kailangan ipagtanggol at ipaglaban.

31. Tinignan ko siya sa nagtatanong na mata.

32. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

33. En mi huerto, tengo diversos cultivos de flores y plantas ornamentales.

34. Ayos ka lang ba mahal ko, bakit parang namumutla at namamayat ka? tanong ng binata.

35. Sa labis na pagkagalit ipinadakip mismo ng datu sa mga nasasakupan ang misyunerong nangangaral.

36. Nanghahapdi at waring nasusunog ang kanyang balat.

37. A lot of snow fell overnight, making the roads slippery.

38. The computer works perfectly.

39. Dahan-dahan niyang sinalat ang baso upang hindi ito mabasag.

40. A couple of minutes were left before the deadline to submit the report.

41. Dahil kung anong ganda ng katawan ay siya namang pagkaimpakto ng mukha.

42. Inalagaan ito ng pamilya.

43. Ang sobrang pangamba ay maaaring magdulot ng kakulangan sa kumpyansa sa sarili.

44. Hindi mo matitiis ang mga maarteng tao dahil sobrang pihikan sila.

45. The charitable donation made it possible to build a new library in the village.

46. Bakit ho, saan ninyo ko dadalhin?

47. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

48. Los agricultores deben estar atentos a las fluctuaciones del mercado y la demanda de sus productos.

49. Itinapon nina Fred at Melvin ang basura

50. See you later. aniya saka humalik sa noo ko.

Recent Searches

dividedinantaynagbentajuicepalancaintramurospinakidalainakyatintotanimankomunikasyonespecializadasayokobyggetginagawaclientemighttagalnag-isipnotebookoperatemakaratingnapakahangakusinapresleyboyfriendkanilacanteenmagawapamahalaantulongkaraokeumarawamountnalalaglagrobinhoodputahebruceleopinyamedidaplaniniintayandamingsamecompletamentepyestacornerbeforebalangsingaporesino-sinokarapatanginjuryhamakpanindangbumababamukhanagtatanonggiyeranagtrabahomaibapakistandumilatmallpatiencefrogbatokbalanceslookedtopic,tsinelasquicklyoutpostbubonginsidentebumaliknahigitannanggagamotbumaba1787isinulatmuylaryngitiscontestmulistylesumigtadmagtanimknowlisteningmaglutodalagapositibodisappointitinulostillproveregularmentemakabalikkapilingbakeresearch,mauliniganipagbilileytepagkaawaaccesstumatanglawbienstatussquattertrentapagpasensyahanreservationkanangpagdiriwangangelamabutikatawangnatitirangsinisiragatolsumangkatutubogreatlypag-asanilapitankaysasumingitmaasahanactingpagsisimbangnoonitinaobkartonlabanislapinanoodinalagaanhulingvotesoperativoskamalayankabighapagbibiromuntingmahahawaflavioagenahihiyangbumibitiwkatulongkinauupuangcnicodilaibalikpasangnatuwahallriseipinanganakbringrabegracemarianagosaddictionbighaninapapikitilogkakatapospangakohiramluistalentedmagtipidnaiiritangasiakalabanbuhokpiyanobinangganabiawangdasalwinsmagpa-picturepakisabimarahasbansanovellesbarrierspagkaimpakto2001sinasabiawasumasayawbulahighganito