Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "inumin"

1. Ano ang inumin na gusto ni Pedro?

2. Gaano ko kadalas dapat inumin ang gamot?

3. Inumin mo ang gamot nang minsan isang araw.

4. Puwede ba kitang ibili ng inumin?

Random Sentences

1. La realidad es que las cosas no siempre salen como uno espera.

2. Eh ayoko nga eh, sundae lang talaga gusto ko.

3. Promise babayaran kita in the future. sabi ko sa kanya.

4. I hate it when people beat around the bush instead of just getting to the point.

5. Ang pang-aabuso sa droga ay nagdudulot ng malalang problema sa kalusugan ng mga tao.

6. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

7. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

8. Sasabihin ko na talaga sa kanya.

9. La realidad puede ser cambiante, debemos ser flexibles y adaptarnos.

10. Shaquille O'Neal was a dominant center known for his size and strength.

11. Lumungkot bigla yung mukha niya.

12. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

13. Bag ko ang kulay itim na bag.

14. He's always the first one in the office because he believes in the early bird gets the worm.

15. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

16. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

17. Nag-aapuhap siya ng dispensa mula sa simbahan para sa kanyang mga nagawang kasalanan.

18. This has led to increased trade and commerce, as well as greater mobility for individuals

19. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

20. The momentum of the rocket propelled it into space.

21. Ang kasama naming lalaki ang nag-piloto nito.

22. Ang mga bunga ay nagkaroon ng malaki at maraming tinik na katulad ng rimas.

23. Le travail est une partie importante de la vie adulte.

24. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

25. Sige. Heto na ang jeepney ko.

26. Hindi dapat natin pigilan ang ating mga pangarap, kundi pagsikapan nating tuparin ang mga ito.

27. Naglipana ang mga isda sa malalim na bahagi ng dagat.

28.

29. Hindi ko nakita ang magandang dulot ng kanilang proyekto kaya ako ay tumututol.

30. Nationalism has been a driving force behind movements for independence and self-determination.

31. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

32. Effective communication and teamwork are important for a successful and productive work environment.

33. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

34. Aalis na nga.

35. Doa adalah salah satu bentuk hubungan spiritual yang penting dalam hidup manusia di Indonesia.

36. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

37. We have seen the Grand Canyon.

38. Ang laki-laki ng cardigan na ito.

39. Para cosechar las almendras, primero se deben sacudir los árboles con cuidado.

40. No dejes para mañana lo que puedas hacer hoy.

41. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

42. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

43. Stop beating around the bush and tell me what's really going on.

44. The politician made a series of speeches, outlining her plans for improving healthcare.

45. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

46. Mathematics can be both challenging and rewarding to learn and apply.

47.

48. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

49. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

50. Hoy en día, el internet es una parte integral de la vida cotidiana.

Similar Words

Iinumin

Recent Searches

encounterinuminoutpost18thcoinbaseavailabledalandanmisusedoliviacafeteriafireworks10throsekablanbagyocompostelaproperlybatowalisroughhighestmapaitemskapilinglibaghapdibroadcastingtipseparationprovidedstoplightkitnotebookjeepneykulturisinalangparehasinvitationtiyannagpakunotpagngiticompletamentenaglaonkapataganmakahingilookeddawsultanassociationbalancespagkakatumbaterminobangkabingidalawaadvancedbakebubonghalu-haloaregladosyangmagbabakasyontelefonermaliliitjustbayawakcultivationmasasamang-loobpatuloynapabuntong-hiningalapisbakuranfulfillmentnaglabatanawabainintayenerothankpusalaybrariingatantungawprobablementebusbeseskaniyaentertainmentomfattendeenergytinapaymatangumpaybantulotbunutanagilanatuloybanlagpinagbubuksanpinagpatuloynagpapaigibressourcernenapakamisteryosoginugunitaadvertising,kinamumuhiankategori,pusosingerikatlongbintanagubatmagpakaramipropesorpagdiriwangsementeryoindustriyasugatangiyamotpatakbongcombatirlas,starsnapanoodaanhintumahimikminu-minutopronountobaccomakahirampagkuwapresidentialnanghihinakaloobangbakataxikuripotmahuhulicompaniesmaghihintaytog,mahabollumutangpabulongnagsinenanunuritindanaglahowatawatnakahugengkantadangnagmistulangnagcurveculturesunud-sunurantatagalencuestaspamilyanaiyaktvskinagagalakincludeipinalutobetweenberkeleyyeahskillandysamasteeritlogregularmentestartvegaslagaslasisubogrocerytraditionalnanigassumasakaymaluwagginoongnahantadkanayangwakasrenatodissepangkatbagkusiniintaysinenogensinderestawranself-defensehimayinaniyascottishhmmmmverdencomputere,choiipantalop