Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "christmas"

1. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

2. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

3. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

4. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

5. Frohe Weihnachten! - Merry Christmas!

6. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

7. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

8. Merry Christmas po sa inyong lahat.

9. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

10. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

11. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

12. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

Random Sentences

1. Hindi lang nila naririnig kundi nakikita pa ang katuwaan ng lahat.

2. We should have painted the house last year, but better late than never.

3. Makakarinig ka ng halinghing sa gym, lalo na kapag may nagta-training ng cardio.

4. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

5. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

6. ¡Feliz aniversario!

7. Sadyang mahirap ang pag-aaral ng calculus.

8. Pakibigay sa tindera ang tamang bayad para hindi siya malugi.

9. Have you tried the new coffee shop?

10. Les impôts sont une source importante de revenus pour l'État.

11. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

12. Kapag ako'y nakakapaglaan ng sapat na oras para sa pahinga at pag-aalaga sa aking sarili, ako'y nakakaranas ng isang matiwasay na pamumuhay.

13. Lee's influence on the martial arts world is undeniable

14. When life gives you lemons, make lemonade.

15. Ang pagkakaroon ng positibong pananaw ay makatutulong sa pagharap sa mga hamon ng buhay, samakatuwid.

16. Every year, I have a big party for my birthday.

17. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

18. Naging malilimutin si Carla mula nang magkasakit siya.

19. Electric cars can help reduce dependence on foreign oil and promote energy independence.

20. Umayos ka nga! Wala ka sa bahay!

21. Ang mga pamilya ay nag-aayos ng mga handa at nagdadasal para sa kasaganaan sa darating na taon.

22. Tila siya ang paboritong estudyante ng guro.

23. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

24. Salamat ha. aniya bago ako makapasok sa kwarto.

25. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

26. Einstein was a pacifist and spoke out against war and violence throughout his life.

27. Ang snob naman neto. Alam mo ba kung anong oras na?

28. Ibinigay ni Ana ang susi sa kanya.

29. Hala, change partner na. Ang bilis naman.

30. Les salles d'hôpital sont souvent partagées entre plusieurs patients.

31. The scientific method involves forming hypotheses and testing them through experiments.

32. Ada berbagai jenis kucing yang ada di Indonesia, seperti kucing Persia, Siamese, dan Scottish Fold.

33. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

34. Siya ay tulala at di maka-react nang maigi sa nangyayari sa kanya.

35. Ang pag-ulan sa labas ay animo'y nagpapaligaya sa mga halaman sa hardin.

36. Minsan, ang mga tao ay nagigising sa gitna ng gabi at nahihirapan na makatulog muli.

37. Limitations can be frustrating and may cause feelings of disappointment and failure.

38. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

39. Tumalikod siya bigla saka pumasok sa kwarto niya.

40. Tuwing sabado ay pumupunta si Nicolas sa palasyo para dalawin si Helena.

41. Hinde ka namin maintindihan.

42. Doon nyo sabihin ang gusto nyong sabihin at doon nyo gawin ang gusto nyong gawin

43. Dumating siya mula sa Bikol kahapon ng umaga.

44. Paano po kayo naapektuhan nito?

45. The website's design is sleek and modern, making it visually appealing to users.

46. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

47. Hinawakan ni Jigs yung kanang kamay ni Athena.

48. Cuídate mucho de esas personas, no siempre son lo que parecen.

49. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

50. Taman Safari Indonesia di Bogor adalah tempat wisata yang menampilkan satwa liar dari berbagai belahan dunia.

Recent Searches

rieganatalomaaksidentebihiramabibingichristmaspasensyaskillsalintuntuninbayangmatalimsakayasawaallepakaininsinisishadeskamalayanmawalanapakahinanapabigaelhinampasmalasutlaligalignamintsinelasbutasnahulaanindependentlykaybilispnilitbaguioinastanilapitannapadaancashopportunitytelevisionidiomabumangonejecutansumpainsinakopsalesrabbamasarapcarolgigisingpatiencekailanbisikletatomorrowsinajennyenglandprosesoandamingpusobalangmarmaingbiliboutlinedailysitawknightkarangalanparurusahancniconagisingaddictiontinitindawifiinakyatpakilutobinatangsignayoko1954membersnatandaankongmartesmaskimedyosetyembremagkasinggandahverhumblepataykaraokelinggoneahousebotocalciumcellphonegenebutihingdaladalamedidablusangdalawautilizainiinomcelularespriestdinanasshorthydeldisappointatentocollectionsshowsjokebinigaybagyopropensokare-kareconsistpiergatheringrosadeterioratenasabingsinagotfonostonehamdontsinongunabansaavailableoutlinesoftenreturnedincreasesryanmastermereactioninvolvepracticesstatingalignseachasahaneroplanosinehanracialparoroonatulalapamamahingaforstånilolokoreviewmatamanmatapangpusakasalananplagasbulakpamimilhingandressagaptrensangbateryanatapostinanggapalamidbuslousogabingfar-reaching11pmisaaciniwanradioreplacedsantowalngduonpiecesmodernenoosobrawidespreadaalisnatingalalabingmatangformasabenescientistkinakitaannaglalatangtakesellaniya