Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "christmas"

1. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

2. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

3. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

4. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

5. Frohe Weihnachten! - Merry Christmas!

6. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

7. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

8. Merry Christmas po sa inyong lahat.

9. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

10. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

11. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

12. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

Random Sentences

1. Hulyo ang kaarawan ng nanay ko.

2. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

3. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

4. Bilang paglilinaw, ang pondo para sa event ay galing sa donasyon, hindi mula sa pondo ng paaralan.

5. Hinde kasi ako mapakali kaya pumunta ako dito.

6. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

7. Walang ilog ang hindi puno ng isda.

8. Kucing di Indonesia juga terkenal dengan sifatnya yang suka tidur dan bermalas-malasan.

9. Pagkatapos pumili ng lugar, dapat mong magsimula sa pamamagitan ng pagpapakalat ng compost o fertilizer sa lupa bago magsimula sa pagtatanim

10. May mga espesyal na pagdiriwang tuwing Linggo sa aming komunidad malapit sa karagatan.

11. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

12. Ibinigay niya ang kanyang tiwala sa akin upang mamuno sa proyekto.

13. La creatividad es una habilidad que se puede desarrollar con la práctica y el esfuerzo.

14. Hugis katawan ng nakahigang babae ang bundok makiling.

15. Go on a wild goose chase

16. Have you tried the new coffee shop?

17. Mas lumakas umano ang ekonomiya matapos buksan muli ang mga negosyo.

18. Les salles d'hôpital sont souvent partagées entre plusieurs patients.

19. Magdoorbell ka na.

20. Mie goreng adalah mie yang digoreng dengan bumbu-bumbu khas Indonesia hingga terasa gurih dan pedas.

21. A series of earthquakes hit the region, causing widespread damage.

22. Maraming mga tao ang nakatambay pa rin sa mga tindahan sa hatinggabi.

23. Ang mailap na mga bagay ay kailangan paglaanan ng oras at pagsisikap upang makamit.

24. Pumunta kami sa Cebu noong Sabado.

25. Alay ko sa iyo ang bawat sandali ng buhay ko.

26. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

27. Walang telebisyon sa kuwarto ni Fiona.

28. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

29. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

30. Ano ba problema mo? Bakit ba ayaw mong magpa-ospital?!

31. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

32. Ibinigay niya ang kanyang panahon upang magbigay ng kaunting kasiyahan sa mga taong malungkot.

33. Tsss. aniya. Kumunot pa ulit yung noo niya.

34. Isang makisig na binata na halos kaedad din ng magandang prinsesa.

35. Hindi lang si Padre Abena ang gusting tumulong kay Tony maging si Mang Ernan na kasama niya rin sa bilibid

36. Omelettes are a popular choice for those following a low-carb or high-protein diet.

37. Sa mga panahong gusto kong mag-reflect, pinapakinggan ko ang mga kanta ng Bukas Palad.

38. Di na ako magtataka dahil alam ko naman ang nangyari.

39. My name's Eya. Nice to meet you.

40. Dyan ka lang ha! Wag kang lalapit sakin!

41. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

42. They have adopted a dog.

43. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

44. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

45. Tumagal ng ilang minuto bago natapos ang palabas.

46. Dadalo si Trina sa workshop sa Oktubre

47. Nanggaling ako sa isang malakas na liwanag papunta sa pagdidilim ng gabi, kaya't nahirapan akong mag-adjust sa aking paningin.

48. Libreng nakakakuha ng atensyong medikal ang lugar nila Alfred.

49. Emphasis is an important component of artistic expression, such as in poetry and music.

50. The early bird catches the worm

Recent Searches

christmasmabuhaysumakitcoaching:bilhinpasahemaliitsumalisalesnagtalaganalalaglage-bookseconomicnapatawagpananglawnakadapawestbibisitaprobinsiyagratificante,nakaluhodpodcasts,sistervirksomheder,villagenagtrabahoyouthgumagalaw-galawpakistangayundininspirationtelahinihintaytaksinagpasalamatpaghaharutanellanakakatawaiskolaranganwarigawinmatitigaspahaboldisenyongnobodynapuyatmataposbagyowowsinasabianumangdaysnapabayaanmayabongpasaheroabangankatabingestablishsilbingtulangnapaiyakmaisusuotalokbalitaexplaincomputereandroidfatallumulusobputingnapapahintoguidanceitlogbehavioraffectnapahintoincidencemakapaibabawdumilimworkinggabrieltracksofatakboinatupagnakabawinanaloorderinkinavirksomhederuusapanlondonriyan1980resultpatiencekaratulangnapakahanganakaraanpagkabiglameriendavictoriadamitniyaagwadorespecializadasyumaoperfectnalagutantatawagmakaipontasaplayswashingtone-commerce,dalawipantalopchoiceumaagosbalancesdumilattumindigmagbabakasyonpagkalapitipinalitlagnatsinongwastefrogdulotbatokpaggawabumabasinumangmaratinginiintayexcuselikeskalarosahignaglulutopatayvivamuchosdalawampuhandaandaliribumilismauupobighanipalagingherundereksamcompartenmaglabagawingflylookedhmmmgenerationerbilerwithoutvampiresctricasanimoyngingisi-ngisingorashiningidiseasenapagodbagyongminutoisipbubongobstacleshumbletarciladedicationpagpanhiknagwagimagagamitnaggingfistsconectadosreduceddefinitivofacultynagbabalacertainbasketbolnakalagaypag-aanisinabirelopagsumamomahabaangkantsaapapayag