Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "christmas"

1. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

2. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

3. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

4. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

5. Frohe Weihnachten! - Merry Christmas!

6. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

7. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

8. Merry Christmas po sa inyong lahat.

9. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

10. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

11. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

12. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

Random Sentences

1. Sa gitna ng pagkabigo, hindi maiwasan ang paglabas ng malalim na himutok.

2. It is important to identify the cause of frustration in order to find a solution and alleviate the negative feelings associated with it.

3. We admire the dedication of healthcare workers in the midst of the pandemic.

4. Ah ganun ba sabi ko habang naka tingin sa cellphone ko.

5. Bigla niyang mininimize yung window

6. ¿Cuándo es tu cumpleaños?

7. Si Ogor ang kinikilalang hari sa gripo.

8. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

9. Hindi dapat nating pabayaan ang ating mga responsibilidad sa buhay, samakatuwid.

10. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

11. Ang Ibong Adarna ay patuloy na nakakaakit ng mga mambabasa sa ngayon dahil sa kanyang pagpapakita ng kagandahan ng kultura at panitikan ng Pilipinas.

12. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

13. Ang bayanihan ay nagpapakita ng kahalagahan ng pagtutulungan at pagkakaisa sa pagharap sa mga suliranin.

14. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

15. Ultimately, a wife is a partner and equal in a marital relationship, contributing to the success and happiness of both spouses.

16. Me encanta pasar tiempo con mis amigos jugando al fútbol.

17. Naglalaway ako sa amoy ng niluluto mong adobo.

18. Membuka tabir untuk umum.

19. Sa paghahanap ng solusyon sa mga palaisipan, mahalaga ang tamang pag-iisip, pag-aaral, at eksperimentasyon.

20. Ako ay may kaugnayan sa iyo sapagkat ako ang nagbiyaya sa iyong mga magulang upang ikaw ay isilang dahil sa kanilang busilak na kalooban.

21.

22. "Dogs never lie about love."

23. Bumangon ka nga jan! Saka paano ka nakapasok!

24. May bagong aklat na inilathala ukol kay Manuel Quezon at tungkol ito sa pag-unlad ng teknolohiya.

25. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

26. Kucing juga dikenal sebagai pembasmi tikus dan serangga di rumah atau tempat tinggal.

27. Les employeurs cherchent souvent des travailleurs expérimentés.

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Wag kang tumabi sakin! paguutos nito.

30. Sariwa pa ang nangyaring pakikipagbabag niya kay Ogor, naiisip ni Impen habang tinatalunton niya ang mabatong daan patungo sa gripo.

31. Paglabas niya ng bahay, nabigla siya nang biglang umambon ng malakas.

32. Ano ang alagang hayop ng kapatid mo?

33. Tila may nais siyang ipahiwatig sa kanyang mga kilos.

34. Kainis ka talaga! sabi ko sabay hampas sa braso niya.

35. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

36. Hindi ako nakatulog sa eroplano.

37. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

38. They have been creating art together for hours.

39. Pagtitinda ng bulakalak ang kanilang ikinabubuhay.

40. Napakaganda ng disenyo ng kubyertos sa restaurant na ito.

41. Pumulot siya ng mga bao ng niyog, gamit na panggatong sa apoy, at hinagis sa lola.

42. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

43. Limitations can be a result of fear or lack of confidence.

44. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

45. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

46. I need to check my credit report to ensure there are no errors.

47. The photographer captured a series of images depicting the changing seasons.

48. Gusto kong manood ng mga pambatang palabas.

49. I am absolutely committed to making a positive change in my life.

50. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

Recent Searches

christmasmaramipopularisinuothagdankulangcheckstaobabynapanoodsilid-aralanniyansalubongpadalaskaaya-ayangbabaesinigangiiwasansaan-saanpaulit-ulitpinagtagpoisinisigawbanganaglalabapresidentialaddictionkinagigiliwangkakilalanakakainunattendedtungosparemagkabilangginagawanakaakmadadaiskopwestoanlabounitedkikomabangongsariwahapagkaysapaki-basamalabobakitsigepulubitahanannagagalitparusakasimagpupuntapinagawapasyentebukodmisteryosonginaliskapwamahirapeskwelahansatisfactionnapilitankoronaanak-pawiseuropesundaloclarakumustanoelkargangtumatawalegacynagdabogasopag-asagitaramayumingkasingtigaspataycnicobilibidhiwagaprimerosinomtradisyonstaplenakagagamotmalakastechnologylongnapakabangotaonsuchsabadoaeroplanes-allhinalibingpagkakamalikaagadkaarawan,naglipanangsatinradionagtatrabahoandoybahagyanahulicorporationskyldesnakabanggamagpakaramimatindiatensyontahimikvillageikawpaladbigyanitinaponadditionhumblepunongkahoyapomaramdamanminabutitypenangingitianbantulotkaraokestarted:asukalmakukulaymaliligopopulationsanapakisabimusmositinulospandidirimetodisknaminbinanggananangisewanmabatongmabangislilypag-aaninatawaguhitnakapilanghimutoknanakawannakatapatipagbiliamazonlipadlumangoymaaksidentekamag-anakpanitikanpasensyanag-umpisapasukanmakalingwalaaaisshdaladalaturonapatigninnakuhangfallaclocksequevoresmatangkadmaytagalogfencingkahilingannakakapasokburmaproyektoasthmamakasahodbusogdilajuliusentoncesnapakasinungalingmalawakpresentationkinukuyompasasaanpangangailangancompostfatal