Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "television"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

3. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

4. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

5. Before television, most advertising was done through print media, such as newspapers and magazines

6. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

7. But television combined visual images with sound.

8. Despite the many advancements in television technology, there are also concerns about the effects of television on society

9. He does not watch television.

10. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

11. In recent years, television technology has continued to evolve and improve

12. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

13. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

14. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

15. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

16. Many schools and universities now use television as a way to provide distance learning

17. One of the most significant impacts of television has been on the way that people consume media

18. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

19. Overall, television has had a significant impact on society

20. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

21. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

22. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

23. Television also allowed for the creation of a new form of entertainment, the television show

24. Television also plays an important role in politics

25. Television has a long history, with the first television broadcasts dating back to the 1920s

26. Television has a rich history, and its impact on society is far-reaching and complex

27. Television has also had a profound impact on advertising

28. Television has also had an impact on education

29. Television is a medium that has become a staple in most households around the world

30. Television is one of the many wonders of modern science and technology.

31. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

32. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

33. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

34. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

35. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

36. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. Sana makatulong ang na-fund raise natin.

2. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

3. Bilang paglilinaw, ang presyo ng produkto ay may kasamang buwis, kaya hindi na ito madadagdagan.

4. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

5. La habilidad de Da Vinci para dibujar con gran detalle y realismo es impresionante.

6. He has been repairing the car for hours.

7. Namilipit ito sa sakit.

8. Foreclosed properties may be sold with special financing options, such as low down payments or low interest rates.

9. Bumabaha sa amin tuwing tag-ulan.

10. Lumayo siya sa amin, waring nais niyang mapag-isa.

11. Isasama ko ang aking mga kapatid sa pamanhikan.

12. Pinakamatipid kong pagkain ay noodles, pero kailangan ko pa rin ng kubyertos.

13. Bakit ba? Hinde ba ko pwedeng magsungit?

14. Saan-saan kayo pumunta noong summer?

15. Uanset ens religiøse overbevisning er påsken en tid til at fejre håbet om nyt liv og genfødsel.

16. His unique blend of musical styles

17. Ano pa ho ang dapat kong gawin?

18. Wala akong opinyon sa bagay na ito, kaya sa ganang iyo, ano ang pinakamainam na hakbang?

19. At sa kanyang maninipis na labi, na bahagyang pasok sa pagkakalapat at maputla, ay naglalaro ang isang ngiti ng kasiyahan.

20. Ilan ang mga puno sa bakuran ninyo?

21. Hiram muna ako ng iyong kamera para kuhanan ang mga litrato sa okasyon.

22. Binuksan ko ito at binasa yung nakalagay.

23. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

24. Ginamot sya ng albularyo.

25. La película que vimos anoche fue una obra sublime del cine de autor.

26. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

27. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

28. Hindi siya makabangon at makagawa ng gawaing bahay.

29. Einstein was a pacifist and spoke out against war and violence throughout his life.

30. Medarbejdere kan arbejde på en sæsonmæssig basis, som landmænd.

31. Sa tuwing nakikita ko ang aking kabiyak, nadarama ko ang kumpletong kaligayahan sa aking puso.

32. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

33. Sa kabila ng kanyang yaman, napaka-maramot niyang tumulong sa charity.

34. A couple of friends are planning to go to the beach this weekend.

35. Hindi ko kayang gawin yun sa bestfriend ko.

36. May nagpapaypay May kumakain ng halu-halo.

37. Gusto ko na talaga mamasyal sa Singapore.

38. Ang mga kawani sa serbisyo-publiko ay dapat na itinuring bilang mga tagapaglingkod ng bayan.

39. Isang umaga habang siya ay naglalakad patungo sa kanilang hardin ay may nakasalubong niya ang isang binata.

40. Sige, tatawag na lang ako mamaya pag pauwi na ko..

41. Imulat ang isipan sa mga kulay ng buhay.

42. Wala na ang beyblade at ang may-ari nito.

43. Wala ho akong dinukot na maski ano sa kanya.

44. Di mo ba nakikita.

45. It ain't over till the fat lady sings

46. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

47. Hirap sa inyo ay sabad kayo nang sabad, e, sabi ng pulis

48. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

49. Paano ho ako pupunta sa Palma Hall?

50. A couple of students raised their hands to ask questions during the lecture.

Recent Searches

televisionhalamantuluyanbahaynag-emailsignificantparabigonghiligroboticshalamananmamataanmahagwayperanggameskumiloscreatehasmarurumikomunikasyonbaranggayfacultynakangisimaskibinilingminamadalimagandangbayaantangingkingoutmagkasamapasyabrainlymuchpresidentialngusoaddictionscientistpackagingdiedrenacentistaeksamginilinghaponngisidiscoveredplacenakiramaypigingschedulebumibilihalakhakpatilucassmallevnepag-amingrinsmagbabayadseparationklimadoonnandiyananigumapangnapakasipagsabipasyalangutomnakilalanag-aalangankasangkapankoreasinigangkasaysayanpulongpowersuniquesigpancitinabotmagpalagopag-aapuhapbumiliautomatisksagotphysicaltumatawadnag-poutmonumentomagkaibigandumarayokunemasasamang-loobfigurepumansintotoongmarieganitoagam-agamdulotofrecenlugartrabahoteamawaareaabundantemagbigayalwaysambagiyannagreklamopilipinaspanghabambuhaybasahinganooniparatingginugunitamalipooknakapuntapangingimifamilykapeteryapaglakilungkothigpitanresearchgruposakahardinnabasapagbebentamediagaganumangbighaniexamanongpusana-curioustumigilpa-dayagonalbeganstormariofeedback,bumabababoyetsakupinharmfulbipolarcornersmaliksilackplayedibabaworldchesspag-unladbukasnatingalasaanamazonaabotnaiwangnagsisihanlittleourleotablevariousbayaninyangbeginningsipinikitanophonechanget-shirtsecarsekangkongrelevantpanindangyoutube,kingdommenugawingkabosesipaliwanagnanoodcedulamaipapautangeducativasmakapasokwriting,nakakaanimnanggagamot