Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

68 sentences found for "impact"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. A lot of money was donated to the charity, making a significant impact.

3. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

4. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

5. Advances in medicine have also had a significant impact on society

6. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

7. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

8. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

9. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

10. All these years, I have been working to make a positive impact on the world.

11. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

12. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

13. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

14. Another area of technological advancement that has had a major impact on society is transportation

15. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

16. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

17. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

18. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

19. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

20. Cancer can impact individuals of all ages, races, and genders.

21. Cancer can impact not only the individual but also their families and caregivers.

22. Effective use of emphasis can enhance the power and impact of communication.

23. Einstein's writings on politics and social justice have also had a lasting impact on many people.

24. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

25. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

26. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

27. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

28. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

29. However, there are also concerns about the impact of technology on society

30. However, there are also concerns about the impact of the telephone on society

31. Human activities, such as pollution and deforestation, have a significant impact on the environment.

32. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

33. L'accès à des soins de santé de qualité peut avoir un impact important sur la santé et le bien-être des populations.

34. Le stress et l'anxiété peuvent également avoir un impact négatif sur la motivation.

35. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

36. Les échanges commerciaux peuvent avoir un impact sur les taux de change.

37. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

38. Les enseignants ont un impact majeur sur la vie des élèves et leur réussite scolaire.

39. Limitations can impact one's career, relationships, and overall quality of life.

40. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

41. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

42. Nationalism can have a positive impact on social and economic development.

43. Overall, television has had a significant impact on society

44. Scientific research has shown that meditation can have a positive impact on mental health.

45. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

46. Smoking-related illnesses can have a significant impact on families and caregivers, who may also experience financial and emotional stress.

47. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

48. Technology has also had a significant impact on the way we work

49. Television has a rich history, and its impact on society is far-reaching and complex

50. Television has also had a profound impact on advertising

51. Television has also had an impact on education

52. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

53. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

54. The impact of the pandemic on mental health has been immeasurable.

55. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

56. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

57. The management of money is an important skill that can impact a person's financial well-being.

58. The power of a single act of kindness can be immeasurable in its impact.

59. The stock market can be influenced by global events and news that impact multiple sectors and industries.

60. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

61. The telephone has also had an impact on entertainment

62. The widespread use of the telephone has had a profound impact on society

63. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

64. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

65. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

66. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

67. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

68. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

Random Sentences

1. Tinangka umano ng pulis na kausapin ang mga nagpoprotesta bago sila buwagin.

2. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

3. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

4. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

5. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

6. Ang pagiging malilimutin ni Ana ay laging nagdadala ng problema sa kanilang grupo.

7. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

8. "You can't teach an old dog new tricks."

9. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

10. Actions speak louder than words.

11. Donald Trump is a prominent American businessman and politician.

12. Different? Ako? Hindi po ako martian.

13. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

14. The executive branch, represented by the President of the United States, is responsible for enforcing laws

15. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

16. Bilang diwata ay wala siyang kapangyarihang magdugtong ng buhay, datapuwa ang magbigay ng panibagong buhay sa bagong anyo ay kanyang magagawa.

17. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

18. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

19. Happy Chinese new year!

20. All these years, I have been building a life that I am proud of.

21. Hindi ko sinasang-ayunan ang kanilang ideya kaya ako ay tumututol.

22. Brad Pitt is known for his charismatic performances in movies such as "Fight Club" and "Ocean's Eleven."

23. Hindi ko alam kung pano ito sasabihin, hindi na ako magpapaligoyligoy pa, si Helena ay wala na.

24. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

25. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

26. Andyan kana naman.

27. Nakagagamot ng diyabetis ang halamang ito.

28. Bawal mag-abuso ng kapangyarihan dahil ito ay isang krimen.

29. Kucing di Indonesia diberi makanan yang bervariasi, seperti makanan kering dan basah, atau makanan yang dibuat sendiri oleh pemiliknya.

30. Hindi mo alam kung maarte siya o hindi dahil hindi siya masyadong nakikihalubilo sa ibang tao.

31. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

32. Masakit mang tanggapin, sa pamilya pa rin ang tatak ng iyong pagkatao.

33. Claro que puedo acompañarte al concierto, me encantaría.

34. Sa gitna ng kalsada, napansin ko ang isang maliit na bata na napapalibutan ng matinding pagdidilim.

35. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

36. Patients are usually admitted to a hospital through the emergency department or a physician's referral.

37. They have seen the Northern Lights.

38. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

39. Inakalang totoong kaibigan ang kasama niya, pero pinagsisinungalingan siya.

40. La película que vimos anoche fue una obra sublime del cine de autor.

41. Walang anuman saad ng mayor.

42. The widespread use of the telephone has had a profound impact on society

43. Nakipag bahay-bahayan kay Athena.

44. Hawak niya yung kamay ni Gelai habang palapit sa amin.

45. Tak kenal maka tak sayang.

46. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

47. Translation: I cannot change the past, I can only accept it with "what will be, will be."

48. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

49. Higupin ng halaman ang tubig mula sa lupa.

50. Gusto kong manood ng sine bukas, bagkus magbabasa ako ngayon ng libro.

Similar Words

impactsimpactedimpacto

Recent Searches

impactpagtatanimwowkahitnamasyalaabotwasakasignaturakalayaanmanykantahanvariedadkakauntogdivisionsulattuwangmemorialgagawasentimossalonngunitsinasagotkumitaalitaptapgawinmagpapagupitochandoplagaswonderbolafurpagkatikimgraphicperokanawaldohinipan-hipankinausaplinyalifemakitaguestsniyogpagpasensyahanpagpapakalatabanganroboticpaggawahimigdenimportantehayopitaymatumalfacultylumakadfallcakenanggigimalmalparawaterberkeleymaliksimarahasnasasabihankatapatthanksgivingnaglulutonagsasanggangwishingskillsneedlessulongnag-poutakinpangakowayospitalinterviewingkatipunantulisanpakikipagbabagwhethernaisubopinalutopangyayaringsimbahansinisiwhysinasabipaglipaspeer-to-peermesasunud-sunurangoodgngmessagepinangyarihanpuedemalinisrocklupalopmarkedlunesjenymaipagmamalakingryanpagkalipasnatigilanbulalasnaaksidentematindiramdamkagalakanshouldtransmitidaswalang-tiyakpangkaraniwanmag-isangnagkakakainlivenahuhumalingsilacelebrayakapinhumampaschickenpoxoftenmunatinahakbangyamannakabawiatingtayoangelagutomnewskapaggayunmanlakaskagipitanyanghudyatpagkapasoktagumpaypakinabanganconventionalbreakabermataliksementeryosiyadagat-dagatanwesleypartenfermedades,paghuhugaskenjiililibrehitsurasumibolinternacionalseryosohumbleyeahhidinghagdanguiltykapatawarangospelendingdreamsdraft:indvirkningdidingpatpatbagsakdaraanbagkusindividualsdaliribadingcreceratentoimportanteschartsarturobukakaannikamagpa-pictureenvironmentbasketworryaffectfuturewriteparehongvitaldiscouraged