Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

26 sentences found for "platform"

1. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

2. Bilang paglilinaw, ang pagpupulong ay gaganapin sa online platform, hindi sa opisina.

3. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

4. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

5. Facebook Marketplace is a platform where users can buy and sell items locally.

6. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

7. Instagram has become a platform for influencers and content creators to share their work and build a following.

8. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

9. Instagram is a popular social media platform that allows users to share photos and videos.

10. Investors can purchase shares of stocks through a broker or online trading platform.

11. Lazada has faced criticism over counterfeit products being sold on its platform.

12. Lazada is an e-commerce platform that operates in Southeast Asia.

13. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

14. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

15. The app has also become a platform for discovering new music, with songs going viral through TikTok.

16. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

17. The platform has also been criticized for promoting harmful content and contributing to online bullying.

18. The platform has implemented features to combat cyberbullying and promote a positive online environment.

19. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

20. The stock market is a platform for buying and selling shares of publicly traded companies.

21. The train was delayed, and therefore we had to wait on the platform.

22. TikTok has become a popular platform for influencers and content creators to build their audience.

23. TikTok is a social media platform that allows users to create and share short-form videos.

24. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

25. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

26. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

Random Sentences

1. Ang ganda naman ng bago mong phone.

2. Bumili kami ng isang mapa ng kalakhang Maynila para mas magaan ang pag-navigate sa lungsod.

3. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

4. Ngumiti lang ako sa kanya at nagsimula muling halikan siya.

5. Natatandaan ko pa nung bata ako na nagtatawanan kami ng mga kaibigan ko habang kumakain ng pulotgata.

6. Maaliwalas ang panahon kaya itinuloy namin ang piknik.

7. Las heridas profundas o que no dejan de sangrar deben ser evaluadas por un profesional médico.

8. Ang pagsusulat ng mga saloobin at damdamin sa pamamagitan ng journaling ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

9. Pedro at Juan ang mga pangalan namin.

10. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

11. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

12. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

13. Me siento mejor cuando me rindo al destino y acepto que "que sera, sera."

14. Dahil kung anong ganda ng katawan ay siya namang pagkaimpakto ng mukha.

15. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

16. Ang hinagpis ng isang ina ay dama sa kanyang bawat hikbi habang inaalala ang kanyang nawalang anak.

17. Have we seen this movie before?

18. Bilang paglilinaw, ang pagsusulit ay hindi bukas kundi sa susunod na linggo.

19. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

20. The reviews aren't always reliable, so take them with a grain of salt.

21. The damage done to the environment by human activity is immeasurable.

22. We have been cooking dinner together for an hour.

23. Sinalat niya ang kanyang bulsa ngunit wala roon ang kanyang cellphone.

24. Sumapit ang isang matinding tagtuyot sa lugar.

25. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

26. I accidentally spilled the beans about the surprise trip, but she was still excited.

27. At tage ansvar for vores handlinger og beslutninger er en del af at have en god samvittighed.

28. I don't like to make a big deal about my birthday.

29. Hindi niya namalayan na tatlong oras na siyang tulala sa harap ng kanyang computer.

30. Iwanan kaya nila ang kanilang maruming bayan?

31. Les médecins et les infirmières sont les professionnels de santé qui s'occupent des patients à l'hôpital.

32. La realidad es que necesitamos trabajar juntos para resolver el problema.

33. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

34. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

35. Lumiwanag ang buong silid nang buksan ang ilaw.

36. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

37. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

38. Parang gusto ko nang magka-baby. pagkuwan eh sabi niya.

39. The internet is full of fashion blogs. They're a dime a dozen.

40. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

41. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

42. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

43. Budgeting, saving, and investing are important aspects of money management.

44. Hinde na ko nag dalawang isip pang lapitan sila.

45. Jeg har fået meget værdifuld erfaring gennem min karriere.

46. Nagsasama-sama ang mga Pinoy tuwing Pasko para magdiwang.

47. The objective of football is to score goals by kicking the ball into the opposing team's net.

48. Mahalagang magkaroon ng budget plan upang maiwasan ang pagkakaroon ng utang.

49. Gusto ko lumabas pero malakas pa ang ulan.

50. Gawa sa faux fur ang coat na ito.

Similar Words

platforms

Recent Searches

platformmakingleftaggressionanotherstoplightwouldbownaiinitankamakalawanagkaganitomicapagkaraantoolisamanagagamitprovidemakakawawanahawakanmalagomaligonagpadalafinishedtotoongkabighaeasyrevolucionadogainmang-aawitwebsitehayaangnaiwangniyanmakasahodsusundotulisanasukalnalalaglagmauliniganhvordankumakainpayongbilaoestilosnapapalibutannegosyantetumiradistanciakanilabalotmasayasabogtutubuinhetoinalokmagdamagansnanakatayoinasikasoclassespag-ibignailigtastunaytrainsangkingapelyidosurveysmawalat-ibangngisinagpapanggapcontentespanyangpeer-to-peerproducirknowbinibinikalakiprofessionalochandobumabapwedengfacilitatingpunongkahoyilalimmanghikayatngunitnag-aralkapatagansasabihin1982nasilawligaligbinge-watchingmagkakarooncubiclenasaangpinatidaroundnyaniniwanbumababamahagwaynegro-slavesplatformsalas-diyesgustingmakapanglamangfreepananghaliandecisionsmag-ina300ibapaki-ulitnaintindihanmatigastupelopinapataposhandaankinsestruggledrinrevolutionizedsabigabrieloutlineeducationsabadongmayamanpaksamangangahoypagngitinahuhumalinginspirasyontinaasanjuangmumuranananaginipnagpapaigibkagandahagnangampanyapagpapatuboposporomakapangyarihangikinabubuhaymedya-agwanakikini-kinitakrusnalugmokkaharianumaganglumusoblumipadmagawatig-bebeintekamalianipinauutangkakilalasapatoshagdananregulering,englishplantastaxinamumulamakapagempakepagtatakaincitamentertalinotiempostinikmanpapalapittienenbinuksansinehanmagandang-magandasahodtagalbihasabenefitskanannagplayskyldesnamabuntisinalagaanlayawalasmataasdespuesmatamankainisboracaylapitantinanggapmaarikwebakapemorena