Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

26 sentences found for "platform"

1. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

2. Bilang paglilinaw, ang pagpupulong ay gaganapin sa online platform, hindi sa opisina.

3. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

4. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

5. Facebook Marketplace is a platform where users can buy and sell items locally.

6. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

7. Instagram has become a platform for influencers and content creators to share their work and build a following.

8. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

9. Instagram is a popular social media platform that allows users to share photos and videos.

10. Investors can purchase shares of stocks through a broker or online trading platform.

11. Lazada has faced criticism over counterfeit products being sold on its platform.

12. Lazada is an e-commerce platform that operates in Southeast Asia.

13. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

14. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

15. The app has also become a platform for discovering new music, with songs going viral through TikTok.

16. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

17. The platform has also been criticized for promoting harmful content and contributing to online bullying.

18. The platform has implemented features to combat cyberbullying and promote a positive online environment.

19. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

20. The stock market is a platform for buying and selling shares of publicly traded companies.

21. The train was delayed, and therefore we had to wait on the platform.

22. TikTok has become a popular platform for influencers and content creators to build their audience.

23. TikTok is a social media platform that allows users to create and share short-form videos.

24. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

25. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

26. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

Random Sentences

1. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

2. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

3. Está claro que necesitamos más tiempo para completar el proyecto.

4. Masyado ka naman nagpapaniwala kay Andrew!

5. Menghabiskan waktu di alam dan menjalani gaya hidup yang sehat dapat meningkatkan perasaan kebahagiaan.

6. Magkaiba ang ugali nila, si Amparo ay tamad at walang kinagigiliwang gawin kundi ang lumapit sa mga bulaklak at amuyin ito.

7. Ketika dihadapkan pada tantangan, penting untuk memiliki sikap positif dan optimis.

8. Tinigilan naman ni Ogor ang panunukso.

9. Nagsusulat ako ng mga pangungusap sa papel upang ma-praktis ang aking bokabularyo.

10. She prepares breakfast for the family.

11. Ang taong nagigipit, sa patalim kumakapit.

12. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

13. But television combined visual images with sound.

14. Napasigaw ang naghihinagpis na ina! Hindi nito maatim ang nakikitang paghihingalo ng mga anak.

15. The elephant in the room is that the company is losing money, and we need to come up with a solution.

16. Sa anong materyales gawa ang bag?

17. Det giver os mulighed for at udføre mange forskellige opgaver, fra simpel redigering af tekst til avancerede beregninger og simuleringer

18. Using the special pronoun Kita

19. I accidentally let the cat out of the bag about my friend's crush on someone in our group.

20. Sa Chinese New Year, ang mga tao ay nagpapakasaya at nagdiriwang ng malakas.

21. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

22. Online traffic to the website increased significantly after the promotional campaign.

23. We have a lot of work to do before the deadline.

24. Samahan mo muna ako kahit saglit.

25. Ang talumpati ng senador ay ukol sa mga reporma sa edukasyon.

26. Nagluluto si Tess ng spaghetti.

27. Ang mga hanging taniman ng mga orchid ay gumagawa ng isang maganda at mayabong na tanawin.

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Matutulog ako mamayang alas-dose.

30. Nang magkaharap ang mag-ama, ang kanyang ama ay hindi niya ito tinanggap

31. Laking gulat niya nang mawala ang batang umiiyak.

32. Pagkatapos siyang kausapin ng hari ay dumeretso si Nicolas sa simbahan at siya ay nagdasal.

33. Nang mag-asawa ang mga kapatid ni Psyche, humingi siya ng payo kay Apollo kung sino ang dapat mapangasawa niya.

34. Los héroes son ejemplos de liderazgo y generosidad.

35. Bestida ang gusto kong bilhin.

36. Mamimili si Aling Marta.

37. Tinanggal ko na yung maskara ko at kinausap sya.

38. Waring hindi pa handa ang kanyang puso na magmahal muli.

39. Nasa sala ang telebisyon namin.

40. Pinagsulat si Jayson ng pangungusap sa pisara.

41. Bakit ba gusto mo akong maging bestfriend?!

42. Lumapit sakin si Kenji tapos naka smile siya.

43. Dadalaw ako kay Lola Sela bukas.

44. Nakakamangha ang paglalagay ng pulotgata sa bao ng niyog upang makagawa ng kakanin.

45. Marahil ay hindi mo muna dapat gamitin ang pera mo sa pagbili ng bagong gadget.

46. He does not break traffic rules.

47. Sa simbahan, napansin ng pari ang magalang na kilos ng mga bata sa misa.

48. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

49. Other parts of the world like Burma and Cuba also cultivated tobacco

50. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

Similar Words

platforms

Recent Searches

platformtechnologiesanotherrepresentedmelissaenvironmentbumisitamaihaharaptagaroonmagagawamahihirapplacemag-aaralpinaulanankatandaanmagalingkakatapostiktok,naglulutomagsusuotumiisodhumaloperpektingskirtconstantlypagngitipansittinamaansahodmaibasilid-aralanhinintaygjortkatulongvelfungerendeinventadosinungalingseniorumiilingasulgearforcespasangeeeehhhhitsdevicestripryanfacilitatingdanceminutosequeitemseithermakalaglag-pantybukaspinakamatabangkinapanayamdistansyapagkakatuwaanmalapalasyofestivaleshinimas-himasbuung-buopagsubokmamalasnasasalinankumakaintumalongarbansoskumirotdistanciaberetiumulannatitirangsandwichhappierkamalayanlabahinhuertoretirarsandalingkumustanatitiramauntoghappenedmakulitgreatlycocktailnapatinginresignationeffektivcineredigeringlegendsmedievaljoshreadersbayabassumahodcharmingheyyancallerdeclareventabinabaeyesalapidulocomunicarsereallynangangahoynapabayaankapangyarihangsinasadyapangungusaphinahanaphanapbuhayanumantaxianumanghouseholdakmangbanaladvertisingmatesatayopeppynaturallegitimate,graphiccassandrawarimadurasfatalexcusepuedenumilingvirksomheder,gayunpamanmaipantawid-gutomresponsiblemurang-muranamumukod-tangipagkakapagsalitaunidosnagsunurankonsultasyonfollowing,mangahasnagpapakainnakalilipaspagkaimpaktonagwelgamang-aawitmakikipaglaronagulatpagpasensyahanpagpapakilalapare-parehonakatunghayrevolucionadorenombregobernadoreskuwelahannaglalatangnapaplastikanpinag-usapanpinamalagiikukumparakanikanilangpinagbigyanphilanthropysunud-sunurancancermakuhangnakatagonagpabotkalalarokubyertospagtutolutak-biyakamakailanhouseholdsnakaraankabuntisanpresence,nag-aagawansumusulatkuryentenakahugnapapansintinawagkinalilibingantagaytaynami-misspagamutankidkiranhayaang