Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "magdamag"

1. Magdamag kong naiwang bukas ang ilaw.

2. Magdamag na bukas ang ilaw sa kwarto.

Random Sentences

1. Isinalaysay niya ang pagkapasan sa krus upang iligtas lamang ni Hesus ang mga makasalanang tao sa daigdig.

2. Limitations can be a result of geographic location or access to resources and opportunities.

3. Walang ano-ano ay lumipad at nakita ni Perla ito na pumunta sa halamanan at nagpalipat lipat sa mga bulaklak.

4. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

5. Ang panitikan ay may kakayahan na magbukas ng ating isipan sa iba't ibang kaisipan at ideya.

6. Ang pagmamalabis sa paggamit ng mga plastik na bag ay nagdudulot ng environmental pollution.

7. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

8. Børn bør lære at tage ansvar for deres handlinger og træffe gode beslutninger.

9. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

10. He does not watch television.

11. Tuwing mayo kung ganapin ang eleksyon.

12. The moon shines brightly at night.

13. Dahil sa kagustuhan ng mga tao na matuto ng iba't ibang wika, yumabong ang mga language schools sa bansa.

14. Ang mga tao ay nasiyahan sa nangyari.

15. Climbing to the top of a mountain can create a sense of euphoria and achievement.

16. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

17. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

18. Pagputi ng uwak, pag-itim ng tagak.

19. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

20. ¿Qué edad tienes?

21. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

22. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

23. Scientific research has led to the development of life-saving medical treatments and technologies.

24. Ang pogi ng BF mo Maria, sana-all!

25. We admire the dedication of healthcare workers in the midst of the pandemic.

26. Madalas lasing si itay.

27. Baby fever can affect people of various ages, backgrounds, and genders.

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Anong nakakatawa? sabay naming tinanong ni Sara

30. She is studying for her exam.

31. Hiramin ko ang iyong bike para sumali sa cycling event sa Sabado.

32. Nakikihukay siya ng mga halamang ugat at namumulot ng tirang pagkain.

33. May lagnat, sipon at ubo si Maria.

34. Ailments are a common human experience, and it is important to prioritize health and seek medical attention when necessary.

35. Las hojas de la hierbabuena se pueden usar para hacer té o mojitos.

36. Ibinigay ko ang aking panalangin at dasal para sa mga nangangailangan ng tulong.

37. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

38. Sumama ka sa akin!

39. Nahulog ang saranggola sa puno ng mangga.

40. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

41. Nahuli na ang salarin sa kasong pagnanakaw.

42. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

43. Nag-iisa siya sa buong bahay.

44. Ang mga tulay sa aming bayan ay tinutukoy bilang mga mayabong na likuran na may bulaklak at mga halaman.

45. Bilang panghabambuhay na parusa ay pinamalagi ng Adang manatili sa labas ng Kasoy ang abuhing Buto nito.

46. Ang labi niya ay isang dipang kapal.

47. Disente tignan ang kulay puti.

48. Ang Linggo ng Pagkabuhay ay pagdiriwang.

49. Les neuroscientifiques étudient le fonctionnement du cerveau et du système nerveux.

50. Selain agama-agama yang diakui secara resmi, ada juga praktik-praktik kepercayaan tradisional yang dijalankan oleh masyarakat adat di Indonesia.

Similar Words

Magdamagan

Recent Searches

mabatongnagbabalamagdamagpananglawsiksikanmamasyalbabapiyanobahagyamatagumpaygatasiniresetaconvey,gawingriegafreedomsiikutantibokdialledkapainisipangusting-gustoperseverance,anumaniniangatgustongduwendeibilisiglobukanapatawagpaithitbansaprobinsiyaespanyolnamanghahoneymoonerscarriednaliligomalapadpoliticaltuvopopularipinasyangmejomangepresleyandreskalongadvancetinayletterdalawapetsangbasahincelularestanodmakasarilingtsakamalambinglikessiempreallowingsweetbatoconnectinggivemassesbecominggabingtakesmag-ibapublishedngitilineinissatisfactionmalapitcardpagbahingjaneagareducedcoaching:misalugarsukatdividesfundrisekartonsharechefbringexitencounterfiguresatatabibarsinakopemphasizedneedsnothingappmalakinganotherfallaboywhybehalfstreamingnagbuwismagpaliwanagnakatapatmagkitateknologipepepuntahanstatingtaximawalakakapanoodtawapassivebitiwantools,kararatingbetweennagbibigaydiyosatalagaiginitgitenfermedades,graceumiimikitutoltamarawlatertiyasigeryanproductionpinapalonapakahangabrucenaguguluhandarknumberkumakapitrevolutionerethouseholddali-dalingginaganoonilocosbinabaratfollowedemocionalsiyudadsinocramehawlamagalitbumalikisinamatawananmerchandiseboyfrienddiliginkubodisciplinmaglabaadmiredipinangangakstillrequirenakakapagpatibaymagnanakawpinag-usapanmagpalibretinangkabiologinapakasipagpinagtagpomagbibiyahepumitasmahinognahintakutanpinakidalapalancanamataypinuntahansinasadyasunud-sunurannagtalagainaabotnakalocktutungovidenskabmaglaro