Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "say,"

1. Before a performance, actors often say "break a leg" to each other for good luck.

2. By the way, when I say 'minsan' it means every minute.

3. Don't beat around the bush with me. I know what you're trying to say.

4. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

5. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

6. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

7. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

8. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

9. The ad might say "free," but there's no such thing as a free lunch in the business world.

10. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

11. You're not being direct. Stop beating around the bush and just say it.

Random Sentences

1. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

2. Madalas ka bang uminom ng alak?

3. I am listening to music on my headphones.

4. Samantala sa kanyang pag-aaral ng sining, nagpapahayag siya ng kanyang mga damdamin sa pamamagitan ng mga likhang sining.

5. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

6. Nang maglakad ako sa tabing-dagat, nakakita ako ng mga maliliit na alon na mayabong na puting espuma.

7. Monas di Jakarta adalah landmark terkenal Indonesia yang menjadi ikon kota Jakarta.

8. Na-suway ang driver ng tricycle nang lumabag ito sa batas trapiko.

9. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

10. The app has also become a platform for discovering new music, with songs going viral through TikTok.

11. May basa ng dugo't lupa ang kanyang nguso.

12. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

13. Ang pagbibigay ng alay sa mga diwata ng kalikasan ay isang mahalagang ritwal sa kanilang kultura.

14. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

15. Hindi ako sang-ayon sa mga pahayag ng ilang mga personalidad sa social media.

16. Sa gitna ng laban, nagbabaga ang determinasyon ng boksingero na manalo.

17. Kings have held power throughout human history, from ancient civilizations to modern times.

18. Doa juga bisa dijadikan sarana untuk memohon kesembuhan dan keberkahan atas orang yang sakit.

19. Pasensya na, kailangan ko nang umalis.

20. Påskelørdag er dagen, hvor Jesus lå i graven, og der afholdes ofte en stille og reflekterende gudstjeneste.

21. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

22. Setelah kelahiran, calon ibu dan bayi akan mendapatkan perawatan khusus dari bidan atau dokter.

23. El agua es un tema de importancia mundial y está relacionado con el desarrollo sostenible y la seguridad alimentaria.

24. Nagwalis ang kababaihan.

25. High blood pressure can be managed effectively with proper medical care and self-care measures.

26. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

27. El orégano es una hierba típica de la cocina italiana, ideal para pizzas y pastas.

28. Ilang kilo ng pinya ang binili niya?

29.

30. Pardon me, but I don't think we've been introduced. May I know your name?

31. Les travailleurs doivent se conformer aux normes de sécurité sur le lieu de travail.

32. Selvstændige medarbejdere arbejder ofte på egen hånd.

33. Sasabihin ko na talaga sa kanya.

34. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

35. A couple of candles lit up the room and created a cozy atmosphere.

36. Have they visited Paris before?

37. The game is played with two teams of five players each.

38. Ang hindi marunong tumingin sa pinanggalingan, hindi makakarating sa paroroonan.

39. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

40.

41. At have en klar samvittighed kan hjælpe os med at træffe de rigtige beslutninger i pressede situationer.

42. He is running in the park.

43. In Spanish cuisine, a tortilla española is a thick omelette made with potatoes and onions.

44. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

45. I am not reading a book at this time.

46. Det er vigtigt at huske heltenes bedrifter og lære af dem.

47. Ang hinagpis ng mga nawalan ng tahanan ay ramdam sa kanilang pananahimik.

48. May pitong araw sa isang linggo.

49. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

50. Tila wala siyang naririnig.

Recent Searches

say,isinuotkabiyakjingjinglumabasunidosjejutatanggapinbowlhalu-halomasaganangpagbabantatinuturouniversitycardiganeksempelnamumuladiinmagsisimulanakakaanimmaunawaanmagbakasyonreorganizingsugatanggovernorskapataganmagisipnakangisingbayadkastilangsamantalangnagyayangbarongpulgadaadvertisingsaronglabahineroplanopangarapgrocerymaibigayakmangtrabahohimayingymmonumentoyorkparehassumasaliwnilalangnatitiratagakinintaypinilitlikelynakatinginstockslistahananihinpeppykayabahayvivainfluencesumakyatmissionhigh-definitionfrescoviolencekelanmejotambayanhundredalayplasabangkokubyertosagesnaglalabaasignaturasentenceiikliailmentsniligawanredigeringarbejdermalambingvelstandbasahinbinasasantosinunud-ssunodpeepestarclaseshangaringprimermassesattentioniguhitmoderneresignationemailnatandaanabstainingcoaching:heymentalcompartenmagpuntaparagraphslegendscoatyesninyointyaininilingoverviewdinalastudentsviewsgameleeconectanfistsbehaviorberkeleyablemotionstreamingjohngenerabaamazonhimighumanorawpagtatanimleahfactoreskanikanilangsumusunodimagessyncnamingmalungkotnatulogbreakskyldes,ikinalulungkotnewjuanasampaguitanaroondolyarpinyadesign,inspirasyonnag-angatspentumiyakkuwentobalediktoryanmagtakapangilhimihiyawdisfrutarnailigtasnasasalinanpanalanginkabutihanibinilitinutopmaipagmamalakingnaabutanpagpanhiknapipilitanpamburamagkahawakmakakatakasbaku-bakongmisteryomakipagtaloeskuwelasasagutininasikasomakasilongpagngitinapapatungonagpaiyaktuluyanerlindaadmiredtinungopasaheropinangalanannapahintotumatakbonatatawamaghahabiberegninger