Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

71 sentences found for "like"

1. "Dogs are like potato chips, you can't have just one."

2. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

3. Ailments can range from minor issues like a headache to serious conditions like cancer.

4. Angelina Jolie is an acclaimed actress known for her roles in films like "Tomb Raider" and "Maleficent."

5. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

6. Bagaimana bisa kamu tiba-tiba hilang begitu saja? (How could you suddenly disappear like that?)

7. Cheap sunglasses like these are a dime a dozen.

8. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

9. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

10. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

11. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

12. Hendes ansigt er som et kunstværk. (Her face is like a work of art.)

13. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

14. Hendes hår er som silke. (Her hair is like silk.)

15. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

16. His administration pursued a more confrontational stance towards countries like China and Iran.

17. I don't like to make a big deal about my birthday.

18. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

19. I like how the website has a blog section where users can read about various topics.

20. I usually like to tell a joke to break the ice at the beginning of a presentation.

21. I'm not impressed with his art. Paintings like that are a dime a dozen.

22. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

23. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

24. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

25. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

26. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

27. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

28. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

29. Like a diamond in the sky.

30. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

31. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

32. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

33. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

34. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

35. My girlfriend looked like a beautiful lady when she walked down the stairs in her new dress.

36. Other parts of the world like Burma and Cuba also cultivated tobacco

37. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

38. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

39. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

40. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

41. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

42. Saya suka musik. - I like music.

43. Sayang, apakah kamu mau makan siang bersama aku? (Darling, would you like to have lunch with me?)

44. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

45. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

46. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

47. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

48. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

49. Some people like to add a splash of milk or cream to the beaten eggs for a creamier texture.

50. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

51. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

52. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

53. The backpack was so hefty, it felt like it weighed a ton.

54. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

55. The dog does not like to take baths.

56. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

57. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

58. There's no place like home.

59. This could be physical products that you source and ship yourself, or digital products like e-books or courses

60. Thor possesses god-like strength and wields a powerful hammer called Mjolnir.

61. To break the ice at a party, I like to start a game or activity that everyone can participate in.

62. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

63. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

64. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

65. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

66. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

67. Users can like, react, or share posts on Facebook to show their engagement and support.

68. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

69. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

70. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

71. Would you like a slice of cake?

Random Sentences

1. El arte puede ser utilizado para transmitir emociones y mensajes.

2. Tinaas ko yung isang kilay ko, I'm working for him noh.

3. Børn bør have tid og plads til at lege og have det sjovt.

4. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

5. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

6. Inirekumenda ng guro na magsagawa kami ng mga field trip upang mas mapalawak ang aming kaalaman.

7. Certaines personnes sont prêtes à tout pour obtenir de l'argent.

8. Isa sa paborito kong kanta ng Bukas Palad ay "I Will Sing Forever".

9. Kinuha naman nya yung isang bote dun sa lamesa kaso.

10. Maaliwalas ang paligid sa bukid tuwing madaling araw

11. The objective of football is to score goals by kicking the ball into the opposing team's net.

12. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

13. Musk's SpaceX has successfully launched and landed reusable rockets, lowering the cost of space exploration.

14. Honesty is the best policy.

15. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

16. ¿En qué trabajas?

17. Sa aming probinsya, makikita mo ang mga bukid na mayabong na mga tanim.

18. "Dogs never lie about love."

19. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

20. Las labradoras son muy activas y necesitan mucho ejercicio diario.

21. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

22. Mga nuno, patawarin po ninyo ang aking anak.

23. Bakit sila makikikain sa bahay niya?

24. Anong gusto mo? pabulong na tanong saken ni Maico.

25. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

26. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

27. Omelettes are a popular choice for those following a low-carb or high-protein diet.

28. Selvstændige medarbejdere arbejder ofte på egen hånd.

29. Hindi dapat natin tolerahan ang anumang uri ng paglapastangan dahil ito ay sumisira sa mga pundasyon ng pagkakaisa at paggalang sa isa't isa.

30. Teka, pakainin na muna natin sila. ani Jace.

31. Napatunayan nilang lason ang mga bunga nang isang araw ay may napadpad na manlalakbay sa kanilang bayan.

32. The package's hefty weight required additional postage for shipping.

33. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

34. Sa panahon ng tagtuyot, ang mga ilog at sapa ay halos natutuyo na.

35. Ikaw ang iniisip ko bawat oras ng buhay ko.

36. Aalis na nga.

37. Ilan ang silya sa komedor ninyo?

38. Nosotros disfrutamos de comidas tradicionales como el pavo en Acción de Gracias durante las vacaciones.

39. I'm not impressed with his art. Paintings like that are a dime a dozen.

40. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

41. Umabot sa hukuman ang panaghoy ng mga biktima ng kalamidad para humingi ng hustisya.

42. Vi skal fejre vores helte og takke dem for deres indsats.

43. Hindi lahat ng kaibigan ay laging nandyan.

44. Tantangan hidup juga dapat mengajarkan kita tentang nilai-nilai seperti kesabaran, rasa syukur, dan ketekunan.

45. "Mahalaga ang kalusugan, kaya alagaan natin ang ating katawan," ani ng doktor.

46. How I wonder what you are.

47. Akin na kamay mo.

48. Madalas akong nagbabasa ng libro sa hatinggabi dahil hindi ako makatulog.

49. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

50. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

Similar Words

likeslikely

Recent Searches

likemovingchefdollarpinyuanpetsinunud-ssunodrepresentativespapapuntalending:habitssuchsittingsolidifyaffectsayoeithergappag-iinatbabemeanssorepalaginagkakasyapublicitynasiramagpagupitnapatunayannag-iisipmanahimiklandslidecrazyinabotgodginamotcommunicationasultradeinimbitaeffortsataamazonsilid-aralanrefpamagatleukemiakasingforeverdividescolorkahilingansumigawsundalocapacidadsportsbibisitagalaanbecamebowlulamsawarolledkotsengrecentnaawamahiwagakapatawarankahusayanhinanakitherramientanasiyahancityoftemaishawakkuripotnanaisinhangaringfederalbalingandiagnosticmaiingaypalapagginoongmarinighumanolihiminatakenagbababatatlongbilistsaayourself,kinabukasankasangkapanrelevantkara-karakamaligayacombinedhetokapiranggotipinanganakakinghinalungkatnaiwanggoodeveningconvertidasbalik-tanawbahay-bahayarghninanaisvedvarendenakainuniversitytubig-ulanipinabalottechnologysteamshipssapilitangrebolusyonpinamalagiphilippineinterestpagkabuhaypagbabantababaliknewspapersnapakahabanapakabutinapadungawgreatlynakagawiannagtitindapagdaminagmumukhasupportnaglokohanmaitimnagdarasalmaximizingmatulunginmapagbigaymamanhikancreatingmakikiligomakatulongmahinahongathenaconventionalkatutubomagkasakitmagkapatidlumalangoyabstaininglabinsiyamkonsiyertokaratulangnagdaramdamkapitbahaygusting-gustoipapautangipagtimplaintramurospinakamagalinginfluencesespadaprosperprovecorasusunduinpamumunoincredibleideologieshinihintayhanapbuhayhalinglinggreenhillsgraduationnapasigawginugunitah-hoynaguguluhannakilalanakakapagoddumadatingnakakarinigcancertinutopnagdiretsobinibilanghouseholdminamadaliaga-agarektangguloartificialwednesdayspendingtumatawadawitinstoplight