Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "family"

1. A father is a male parent in a family.

2. A lot of laughter and joy filled the room during the family reunion.

3. Aku sangat sayang dengan keluarga dan teman-temanku. (I care deeply about my family and friends.)

4. All these years, I have been blessed with the love and support of my family and friends.

5. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

6. Dogs can develop strong bonds with their owners and become an important part of the family.

7. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

8. Every year on April Fool's, my dad pretends to have forgotten my mom's birthday - it's a running joke in our family.

9. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

10. He cooks dinner for his family.

11. I absolutely love spending time with my family.

12. I admire my mother for her selflessness and dedication to our family.

13. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

14. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

15. I love to celebrate my birthday with family and friends.

16. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

17. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

18. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

19. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

20. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

21. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

22. Naghingi ako ng pahintulot na hiramin ang kotse ng aking magulang para sa isang family outing.

23. Nagtatrabaho ako sa Mimosa Family Home.

24. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

25. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

26. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

27. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

28. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

29. She prepares breakfast for the family.

30. The king's family and heirs are often closely watched by the public and the media.

31. The patient's family history of high blood pressure increased his risk of developing the condition.

32. The patient's family history of leukemia increased their risk of developing the disease.

33. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

34. The title of king is often inherited through a royal family line.

35. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

36. Weddings are typically celebrated with family and friends.

37. Women have often been the primary caregivers for children and elderly family members.

Random Sentences

1. Ang saya saya niya ngayon, diba?

2. Napaiyak si Aling Pising ng makita ang mga tuyong kahoy at posporo sa ilalim ng kanilang bahay.

3. Musk has faced controversy over his management style and behavior on social media.

4. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

5. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

6. Kapag ako'y nag-iisip nang maayos at walang stress, ako'y nakakamit ng isang matiwasay na pag-iisip.

7. Dahil sa kanyang masamang ugali, siya ay isinumpa ng mangkukulam.

8. May grupo ng aktibista sa EDSA.

9. Sa agaw-buhay na mundo ng sports, mahalaga ang tiwala sa sarili at sa mga kasama sa koponan.

10. Iba ang landas na kaniyang tinahak.

11. Sapagkat matagal na ring sumasamba sa mga anito ang mga katutubo, hirap na hirap si Padre Novelles na manghikayat.

12. Si Anna ay maganda.

13. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

14. Hinawakan ko yung kamay niya.

15. Sunud-sunod na nakatalungko ang mga ito sa isa pang bangkong nas atagiliran ng nanggigimalmal na mesang kainan.

16. Nagpapakain ako ng aking aso sa hatinggabi bago kami pareho matulog.

17. Sa paligid ng balde, nakikia niya ang kanyang anino.

18. Gaano kadalas kang nag-eehersisyo?

19. He applied for a credit card to build his credit history.

20. Siya ang aking kaulayaw sa lahat ng bagay.

21. En mi jardín, cultivo varias hierbas como el tomillo, la albahaca y el perejil.

22. Ipinanganak si Hidilyn Diaz noong Pebrero 20, 1991, sa Zamboanga City.

23. Pagkatapos, dapat mong i-mark ang mga lugar kung saan mo gustong magtanim ng mais at mag-plant ng mga buto sa mga ito

24. Siempre hay que tener paciencia con los demás.

25. La obra social produjo una gran ayuda para los más necesitados.

26. Lumaking masayahin si Rabona.

27. Sa mga bundok, ang mga mountaineer ay nagtatanim ng puno upang mabawasan ang pagkaagnas ng lupa.

28. La música es una forma de expresión que puede ser utilizada para conectarnos con otros y compartir nuestras emociones.

29. Binigyan niya ako ng isang dosenang rosas.

30. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

31. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

32. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

33. Napansin ni Mang Kandoy na ang dugo ng diwata ay puti.

34. Es importante reconocer los derechos y la dignidad de todas las personas, incluidas las personas pobres.

35. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

36. Sa ngayon, makikita pa rin ang kahusayan ng mga gagamba sa paghahabi ng kanilang mga bahay.

37. Sa ganang iyo, tama ba ang desisyong ginawa ng ating gobyerno?

38. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

39. May mga taong nagkakaroon ng mga panaginip tuwing natutulog sila.

40. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

41. Ang buhawi ay maaaring magdulot ng malawakang pinsala sa mga ari-arian, gusali, at mga taniman.

42. Napaka presko ng hangin sa dagat.

43. The host introduced us to his wife, a beautiful lady with a charming personality.

44. Helte findes i alle samfund.

45. Ang magnanakaw ay nakunan ng CCTV habang papalapit ito sa tindahan.

46. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

47. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

48. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

49. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

50. Promote your book: Once your book is published, it's important to promote it to potential readers

Recent Searches

familymapag-asangdependingnapalakassinunggabankapagbestbobotowhichbibigyanmalambotpangitbabasumasagotpooknaguncheckedtv-showsindividualsmedicinenagpuntaabutancomunesnakahainpagapangpag-itimcomunicanjenyoperahanconsuelosisterpinoypinag-aaralanmamamanhikanmarkednagsagawabalitangibotoguerreronagmamaktolleadersactornangminamadalisakimperaamendmenttilpanitikantignansakyanwaitnamissumiinomejecutansmokeranimales,paglipasamobotantepracticadotaonwikamusmosmag-inanag-replyulanpagpapasaninuulcerkayabanganpartnerilihimmismokarapatangenemaalwangpuntahantagapagmanaulomanakbomanuksousapinabilikasinggandabossfialandohinagpisinatupageskuwelasalamatcompartenmakakasahoddumilimmaghaponpaulit-ulitbecomingabangbestidamakapagsalitanilapitantelangninyongsoonlaskinasuklamaniguhitantoniopaghaharutanginagawaburgersaid1787sasayawindispositivopaga-alalanewctilesbinulongbeingnapaiyaknagbiyayanagplaykiloplaystinaasanpaglayasdanskemabangonaalalaarturowidepopularumanosurroundingsinspiredhallmagbayadlargekinakailangancitizensthereforealingngunitdaynag-aralmagsuotkarwahengpinabulaangumandare-reviewnakapagusapexcitedneanaisipnakasalubongborgereinilalabasrebo1990tulunganhuluanywhereipinahamakisiphihigapresence,pingganlangendingdinadasalmaghandaaparadorbuenapansolpinauwitumaholmulighedpinamilihiniritcitizennagagandahanoncemayowithouttipskayakasamaanpublishingorasansinunud-ssunodsignificantevenblusangmatagalparoroonapangakowhatsappgalaannamamangha