Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "said"

1. And she said yes? parang nag-aalangan kong tanong.

2. I sent my friend a bouquet of flowers and a card that said "happy birthday."

3. My daughter made me a homemade card that said "happy birthday, Mom!"

4. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

5. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

Random Sentences

1. Maglalakad ako papunta sa mall.

2. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

3. Si Datu Duri ay matandang-matanda na.

4. Si Hidilyn Diaz ay isang inspirasyon para sa maraming Pilipino, lalo na sa mga kabataan.

5. Gaano ko kadalas dapat inumin ang gamot?

6. Bumili kami ng isang mapa ng kalakhang Maynila para mas magaan ang pag-navigate sa lungsod.

7. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

8. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

9. Bilang paglilinaw, hindi ako ang nagsimula ng usapan, ako lang ang sumagot sa tanong.

10. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

11. Bawal magpakalat ng mga labis na pamahiin dahil ito ay nagdudulot ng takot at kawalan ng kaalaman.

12. Offering forgiveness doesn't mean we have to continue a relationship with someone who has repeatedly hurt us; setting boundaries is important for self-care.

13. Ang bagong linis na kurtina ay nagbigay ng sariwang at mabangong hangin sa silid.

14. Better safe than sorry.

15. Ang sugal ay nagdudulot ng pagkawala ng kontrol at pagkakaroon ng mga labis na panganib.

16. She is cooking dinner for us.

17. Walang puno ang hindi hitik sa bunga.

18. The mission was labeled as risky, but the team decided to proceed.

19. Therefore, we should all steer clear of this bad habit of smoking cigarettes

20. Hindi kita puwedeng iwan dahil mahal kita.

21. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa pag-iisip, emosyon, at pisikal na kalusugan ng isang tao.

22. L'éducation est un élément clé pour le développement personnel et professionnel.

23. Nakaka-in love ang kagandahan niya.

24. Ang rebolusyon ay bunga ng pagkamulat ng mga Pilipino kontra kastila.

25. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

26. The writer published a series of articles exploring the topic of climate change.

27. L'auto-évaluation régulière et la mise à jour de ses objectifs peuvent également aider à maintenir une motivation constante.

28. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

29. Papanhik din sana siya sa tuktok ng burol subalit naabot siya ng rumaragasang tubig-ulan na lalong nagpalalim sa dagat-dagatan.

30. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

31. Mag-iikasiyam na nang dumating siya sa pamilihan.

32. Yey! Thank you Jacky! The best ka talaga!

33. Till the sun is in the sky.

34. En invierno, la nieve puede causar problemas en el transporte, como retrasos en vuelos y cierres de carreteras.

35. When we read books, we have to use our intelligence and imagination.

36. Baket? nagtatakang tanong niya.

37. Nanalo siya ng isang milyong dolyar sa lotto.

38. Nilaos sila ng bata at dahil dito, mas lalong yumabang ang bata.

39. Maramot ang kapitbahay nila at hindi nagpapahiram ng gamit kahit kailan.

40. Hindi ko naiintindihan kung bakit nila gustong gawin ito kaya ako ay tumututol.

41. Every year on April Fool's, my dad pretends to have forgotten my mom's birthday - it's a running joke in our family.

42. Dahil sa iyong pagiging labis na madamot, kahit na marami ka namang pananim na maaring ibahagi sa iyong kapwa, ikaw ay aking paparusahan.

43. El uso de drogas es un problema grave en muchas sociedades.

44. Hindi na sila nasisiyahan sa nagiging asal ng bata.

45. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

46. Hinding-hindi napo siya uulit.

47. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

48. Las hierbas silvestres crecen de forma natural en el campo y se pueden utilizar en infusiones.

49. Puwede siyang uminom ng juice.

50. You can't judge a book by its cover.

Recent Searches

replacedlossserioussaidfeelingpaskospeedidea:altpasoklasingerolimossorryflexibleminutekumarimotfanssumalaconectadosotroimaginationalinnoonmakapilingiginitgitsummitbilingmonitoranotherwaitleadformpapasokitinuringcommerceactivitycomunesinformationexitipapahingakangkongbolapronounhitiknagpabotkinalakihannatutulogkaringdatisiguropagkalungkottoofeedbacknatanggapinilabasyataeventossayotaong-bayanefficientlabascoaching:fiakayamadilimkisstime,amerikapagsumamosuelobranchrosasbumilistomarsumangnakapaligidmaalwangisugalumangoykruspinagkaloobanmarkinventiondailynagtatanimkoronapaanolagnattarcilakanayangnaiiritanghinihintayumiibigprincipalesnamuhaytumamananunuksolot,kumirotmiyerkulespatakbogiyeraoftengelai1970ssementongniyangoperativostalinomahahawakulturtutusinisinusuotpalasyomagbabalarangethirdgitanassyncerrors,napilingfourclassmatemulingjunjunslavetiyanaggingfriendikinamatayhinipan-hipannagre-reviewnagbabakasyonpodcasts,revolucionadokaaya-ayangkaarawannapaluhodpagsisisipagpilimagagawakumidlatnagtutulakkagandahanmaglalarohampaslupapamilihanpagtataaslumalakipagkakamalipagkagisingnecesariopaghangaumiimiksulyapdaramdamingovernmentkwartopresidentetangekspakikipagbabagkusineromatabangnahulaanjackzcineutilizanmanonoodligaliglalimlupainkababalaghangpabiliestadosemocionalisinaraitinaasnabiglaisinuotnocheinintayjobkasuutansandalingandoyjagiyaasiahabitinfusionessiramatikmanmaglalakadibonlalakekumbentobinanggapublishing,siglokutodtigas