Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "decisions"

1. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

2. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

3. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

4. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

5. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

6. Mathematics can be used to analyze data and make informed decisions.

7. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

8. Research and analysis are important factors to consider when making investment decisions.

9. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

10. The uncertainty of the situation has made it difficult to make decisions.

11. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

12. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

13. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

14. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

Random Sentences

1. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

2. Aku rindu padamu. - I miss you.

3. Mahalagang magkaroon ng budget plan upang maiwasan ang pagkakaroon ng utang.

4. En invierno, muchas personas disfrutan de deportes como el esquí y el snowboard.

5. Ngunit wala siyang nararamdaman sakit.

6. Nagkaroon ako ng agaw-buhay na pagkakataon na makapag-aral sa ibang bansa.

7. Anong klaseng kuwarto ang gusto niya?

8. Saan na po kayo nagtatrabaho ngayon?

9. Dito ang mga lalaki at doon ang mga babae.

10. People who give unsolicited advice are a dime a dozen.

11. La guerra contra las drogas ha sido un tema polémico durante décadas.

12. Aus den Augen, aus dem Sinn.

13. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

14. Ang paggamit ng droga ay maaaring magdulot ng pagkakasala, tulad ng paglabag sa batas at pagiging sangkot sa mga krimen.

15. Bumuga siya ng hangin saka tumingin saken.

16. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

17. Ito ang barangay na pinamumunuan ni Datu Diliwariw.

18. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

19. Medarbejdere kan blive tildelt forskellige arbejdstider, som natarbejde.

20. The restaurant bill came out to a hefty sum.

21. The king's family and heirs are often closely watched by the public and the media.

22. Kulay itim ang libro ng kaklase ko.

23. The website's user interface is very user-friendly and easy to navigate.

24. Wag mo na akong hanapin.

25. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

26. Ang pagkukubli ng mga katotohanan ay nagpapahiwatig ng kawalan ng interes sa realidad.

27. Marami ang pumupunta sa Boracay tuwing

28. A series of earthquakes hit the region, causing widespread damage.

29. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

30. Es importante que los gobiernos tomen medidas para ayudar a las personas pobres.

31. La tos puede ser un síntoma de cáncer de pulmón.

32. Ang pagkakaroon ng malubhang sakuna ay binulabog ang buong bansa.

33. Sa isang linggo ay pupunta kami sa Japan.

34. Ang mabuting anak, nagpapalakas ng magulang.

35. How I wonder what you are.

36. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

37. Madalas kami kumain sa labas.

38. The actor received a hefty fee for their role in the blockbuster movie.

39. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

40. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

41. Nag-alala ako nang magdidilim na ang paningin ko habang nagmamaneho sa isang maulang gabi.

42. The company acquired assets worth millions of dollars last year.

43. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

44. Ang Ibong Adarna ay isang sikat na kwento sa panitikang Filipino.

45. Nanalo siya ng Palanca Award para sa panitikan

46. Puwedeng gamitin ang pagguhit upang magpahayag ng mga saloobin at mensahe sa mga taong mahal mo.

47. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

48. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

49. Sí, claro que puedo ayudarte con eso.

50. Lazada's mobile app is popular among customers, with over 70 million downloads.

Recent Searches

kadaratingdecisionskainitanbumaligtadbagaldakilangbritishparaangmasaganangpaglingonnanunuridisyembrenakitulogfridayginugunitanabighanimahiwagangmoderneroughmaubosnothingnatakotevolveinakalapropensonilutohinalungkatpinunitdepartmentlunasbayadlalongnapatinginsumasambagaphiningidadalopinapakingganipanlinismrsnalugmokadventwifitechnologieslabaspagdiriwangbilinghatebadingmakalingisamaresearch:kumaripasstagedoktordontpulubitomorrowmatchinghunigreaterparisukatlaamangmarilousharmainenagsineiniresetasilanginstrumentalsitawmayamanglottoletcebumakapagsabibluecardpangalananinalalayanmakikiraannaiinismagkasakitfitnessnapapasayaiginitgitumilingipipilitbasahincoaching:lucysinasadyamassesskyldes,1000kumampimalambingsakinanitopumitasgameminamasdanenteritutolinfectiouslayasdiwataaniyaarbejdsstyrkeroselleactorbefolkningen,dalawamagsusuothalatangtumikimchadtotoongmarinigkulangnararapatdissemagagandangnyeparonilalangmanghulipokergenerationeriwananairportoktubresamanapansintuwangwriting,viewmatamisyunggatasano-anotalagamaysagingtokyomukaebidensyasiopaoeditorlihimcosechar,manggagalingtinitirhanlandeevneprogramsmaibigayikatlongtindasinghalnakatingingsunud-sunodyepbangmumuradulotsumalakayaayusinpinauwipatisuzettelutuinmagigitingheartbeatsino-sinoipatuloynasasakupanbutomediumtiningnanfirstcakejacky---junjunlaterresponsiblegodttalaganginuulcereconomypresyomanoodtungkodstudentsflashpagsayadyunkunelegendspisngiunidos