Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "decisions"

1. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

2. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

3. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

4. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

5. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

6. Mathematics can be used to analyze data and make informed decisions.

7. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

8. Research and analysis are important factors to consider when making investment decisions.

9. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

10. The uncertainty of the situation has made it difficult to make decisions.

11. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

12. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

13. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

14. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

Random Sentences

1. Pumunta sila dito noong bakasyon.

2. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

3. Matapos ang mahabang panahon ng paghihintay, ang aking pag-aabang ay napawi nang dumating ang inaasam kong pagkakataon.

4. Sa loob ng isang saglit, hindi niya maulit na salatin ang biyak na pisngi.

5. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng stress dahil sa kanyang rational thinking.

6. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

7. Hindi ko matiis ang pagkaantabay sa kanyang mga mensahe dahil gustung-gusto ko siyang kausapin.

8.

9. A couple of minutes were left before the deadline to submit the report.

10. Patuloy ang labanan buong araw.

11. Las serpientes son animales de sangre fría, lo que significa que dependen del ambiente para regular su temperatura corporal.

12. Malilimutin si Marco kaya’t laging paalala ang sinasabi ng kanyang ina.

13. Si mommy ay matapang.

14. Hindi po ba banda roon ang simbahan?

15. La pobreza puede ser un círculo vicioso que se transmite de generación en generación.

16. I know you're going through a tough time, but just hang in there - you're not alone.

17. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

18. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

19. Happy Chinese new year!

20. Paano ako pupunta sa airport?

21. Human activities, such as pollution and deforestation, have a significant impact on the environment.

22. Ang bawat mabangong lasa sa kusina ay nagpapahiwatig ng isang masarap na handa.

23. La guerra contra las drogas ha sido un tema polémico durante décadas.

24. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

25. Iilan pang taon ang nakalilipas sa kanyang pagka-Datu nang siya ay nagkaroon sa kanyang kabiyak ng isang tagapagmana ng kaharian.

26. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

27. Nakaupo ito, taas ang kaliwang paa, sa dulo ng halos dumapa nang bangko.

28. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

29. Ang taong lulong sa droga ay parang nasa bangin na patuloy na bumababa hanggang sa wala na siyang mahawakan.

30. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

31. Ang rebolusyon ang tumapos sa pananakop ng mga kastila.

32. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

33. Hindi dapat natin pahintulutan ang paglapastangan sa karapatan ng mga mahihina at marhinalisadong sektor ng lipunan.

34. Napangiti na lang ako habang naka tingin ako sa kanya.

35. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

36. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

37. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

38.

39. Baby fever is a term often used to describe the intense longing or desire to have a baby.

40. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

41. Umihip ang malamig na hangin, waring may paparating na masamang balita.

42. If you quit your job in anger, you might burn bridges with your employer and coworkers.

43. Si Maria ay nagpapahiram ng kanyang mga damit sa kanyang mga kaibigan.

44. Kumunot lang ang noo ko, That's not my name.

45. Wala yun. Siya naman talaga ang may kasalanan eh.

46. Hindi ako sang-ayon sa pag-uugali ng ilang mga kabataan ngayon.

47. Sana ay maabot ng langit ang iyong mga ngiti.

48. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

49. Pumunta ako sa Laguna noong Sabado.

50. Ikinagagalak kong makita ang pag-unlad mo sa buhay.

Recent Searches

kuryentedecisionsjoylinecigarettehelpfulgumuglongkasinggandananghihinamaddumaramirobertissuescommercerelevantmalakingguiltykitlangthirdmemorysalapibehaviorutak-biyanakatunghaymurang-muranagsisipag-uwiannapaplastikannanatilibarung-barongnaka-smirkmumuntingestablishnagsunurannahuhumalingibinibigaymabihisanhumahangosginawaranmakapagempakebowlbumababamisyunerongtelecomunicacionesginawangbuhoklalongnuevosistemasdemocracyhitiknatagalanmakilingbiliscryptocurrencytoolspagkakatayonakakapagpatibaynakaluhodpinapakiramdamankumantapinakabatangmakatarungangnalagutanitinatapatnakilalaautomatiskproducesalaminmagkanosilid-aralanpinangaralankainitanmaligayamakilalagalaandeletingtinapaykubonasabingbutihinghmmmmulomatindingmanuscriptmagdagenerationscolournagpapaigibpleasehinawakankahirapankakataposlinggongpakikipagbabagstaypawiinsagutinmatangkadniyosamantalangbunutanlilipadtilitataassantosbagamakatulongrelievedcomputere,iniinombinasaairconsumusunocupidarbejdersamepasangfreelancerpagluluksanakaliliyonghabangnapasigawnagkapilatnagtrabahoposporokamiasmaglalabapambatangpagdudugonavigationskirtnaghilamoskanluranpinakamahalagangpakistananumangtotoonanangistasadespuesbutasmarielartistasmatapangituturobundokamericanwarikananuntimelykombinationexcusebatokcalciumgenetodaymatchingbroadcastkablanrestfatalconventionalmaramingarayclassessequeclockpostnagre-reviewmalapalasyosimbahansay,paghahabimakaiponprincipalestakotininomnaalisinintayrabbasumpaindissepusagatheringrosataposjoshnothingsutildulospeedamazondumatingunahinnagnakawnakasandignapakagagandanapapasayanakakatawamakapaibabaw