Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "communication"

1. A successful father-child relationship often requires communication, patience, and understanding.

2. A successful marriage often requires open communication and mutual respect between a husband and wife.

3. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

4. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

5. Effective communication and teamwork are important for a successful and productive work environment.

6. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Emphasis is an important tool in public speaking and effective communication.

9. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

10. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

11. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

12. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

13. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

14. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

15. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

16. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

17. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

18. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

19. Tweets are limited to 280 characters, promoting concise and direct communication.

Random Sentences

1. Pagkababa, mabilis na siyang nagyayang umuwi.

2. Børn bør have adgang til uddannelse og sundhedsydelser uanset deres baggrund eller socioøkonomiske status.

3. Es un cultivo versátil que se puede utilizar para hacer alimento para humanos y animales, y también se utiliza en la producción de biocombustibles

4. Mabait na mabait ang nanay niya.

5. Nasan ka ba talaga?

6. Sa mga matatandang gusali, naglipana ang mga alamat at mga kuwento ng nakaraan.

7. Nagtatanong-tanong ako sa kanyang mga kaibigan upang malaman kung ano ang mga gusto at ayaw ng aking nililigawan.

8. Nagsilabasan ang mga taong bayan.

9. Dala ng hinagpis, nagdesisyon si Mario na magpakalayo-layo upang muling hanapin ang sarili.

10. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

11. Ang kasal ay nagbibigay ng mga ala-ala at emosyon na hindi malilimutan ng mga taong kasama sa okasyon.

12. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

13. Pagkatapos kong maglaba ay pupunta na ako sa mall.

14. May nanganganib na mawalan ng trabaho dahil sa aksidente na nangyari sa paggawa ng proyekto.

15. Sus gritos están llamando la atención de todos.

16. Setiap agama memiliki tempat ibadahnya sendiri di Indonesia, seperti masjid, gereja, kuil, dan pura.

17. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

18. Tengo dolor de garganta. (I have a sore throat.)

19. Ang pag-aalala sa kapakanan ng iba ay isa sa mga pangunahing sanhi ng pangamba.

20. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

21. She enjoys taking photographs.

22. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

23.

24. Sa kabila nito, nanatili siyang aktibo sa politika ng Pilipinas pagkatapos ng pananakop.

25. Sa bawat desisyon na ating ginagawa, kailangan nating isaalang-alang ang bawat posibilidad, samakatuwid.

26. Ang malambot na lilim ng ulap ay nagbigay ng kakaibang kulay sa silong ng buwan.

27. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

28. Mens nogle mennesker kan tjene penge ved at gamble, er det en risikabel investering og kan ikke betragtes som en pålidelig indkomstkilde.

29. Las plantas pueden entrar en un estado de dormancia durante el invierno, reduciendo su crecimiento.

30. Los efectos a largo plazo del uso de drogas pueden ser irreversibles.

31. Taga-Ochando, New Washington ako.

32. Gracias por ser honesto/a y decirme la verdad.

33. Sa tuwing may malaking okasyon, ginaganap ang ritwal ng pagtawag sa mga ninuno upang humingi ng gabay.

34. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

35. Samahan mo muna ako kahit saglit.

36. Magsusunuran nang manukso ang iba pang agwador.

37. Tumango lang ako. Wala ako sa mood na magsalita.

38. Disfruto explorar nuevas culturas durante mis vacaciones.

39. The uncertainty surrounding the new policy has caused confusion among the employees.

40. Gusto naming makita uli si Baby Janna eh. si Maico.

41. Pinakamatipid kong pagkain ay noodles, pero kailangan ko pa rin ng kubyertos.

42. Ang mailap na pagkakataon ay kailangan hanapin sa kung saan-saan upang hindi ito masayang.

43. Pakipuntahan mo si Maria sa kusina.

44. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

45. Ang mga lugar na madalas tamaan ng buhawi ay kailangang magkaroon ng mga pinalakas na imprastruktura at mga hazard mitigation measures.

46. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

47. A palabras necias, oídos sordos. - Don't listen to foolish words.

48. Nagustuhan kita nang sobra, kaya sana pwede ba kita makilala?

49. Children's safety scissors have rounded tips to prevent accidental injuries.

50. Madalas akong nakakarinig ng kakaibang ingay sa labas ng bahay sa hatinggabi.

Similar Words

communications

Recent Searches

legislativecommunicationsinumancongratsilingaleinfinityellenilalagayinvestgumandanaliwanaganisinuotnalalamanpagkalungkotnapaplastikannakuhamahihirapmatapobrengkadalasnaglokohannagbabalanaglokokisapmatanabigyanregulering,nagplayumaganakapikitfieldaffiliatelingidmalapadfridaylamesanagbungaiosencounteranieithergeneratedresultumarawnovellesrelativelypagpanhikthererosariobaonkasangkapanmatagalschoolnaminnamataynakatitiyakkaraokeguestsyoungdesisyonanuulaminnagpalutorightsagekontramanilbihancampaignstawaampliaayawmasarapnoblesparehverpagefreelancerboyetgotbetweensariwafuncionesvigtigstenakasalubongadoboprobinsiyamakikipaglarogayunpamankabutihankumaindogslipadstudentskinakabahanpinapalowalismedya-agwasiyagatolsayomakatulogtemparaturamakaraangumuhitiiwasanlever,tog,kamaliantuwaitinaobagaddiamondvedgreenspaghettiinternetdumatingtiposchecksmonetizingcertain10ththoughtshvoritinaashealthbarnesdespitemagkasabayself-defensepinaghatidannatuwasugatangnakitulogimbescharismaticipaliwanagcarolkutsaritangpatuloybenefitsmaatimphilosophicalaaliskasakitmalayangpunsotandaberkeleyeditturnkulaykaarawannagkakatipun-tiponnageenglishmaglinisinaabutannakatayotaga-nayonnakasandigmakikipagbabagmagkamalimakikiligobalahibokanginajingjingnakatuoncultivartinalikdansocialesbilihinnatatawaeksempelelenatakotlakadhunidealnoongveryhojasnagreplypakpakblesspaslitmalapitrecentspeedattackwhichconsiderfeedbackincreasekumustakamingpaulaibinalitangkamingunitpapanhikmeriendasasamahan