Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "communication"

1. A successful father-child relationship often requires communication, patience, and understanding.

2. A successful marriage often requires open communication and mutual respect between a husband and wife.

3. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

4. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

5. Effective communication and teamwork are important for a successful and productive work environment.

6. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

7. Effective use of emphasis can enhance the power and impact of communication.

8. Emphasis is an important tool in public speaking and effective communication.

9. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

10. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

11. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

12. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

13. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

14. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

15. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

16. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

17. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

18. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

19. Tweets are limited to 280 characters, promoting concise and direct communication.

Random Sentences

1. Hindi naman. Baka lang pagod ka na...

2. Ang baryo nila ay kilala sa taunang paligsahan ng saranggola.

3. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

4. Trapik kaya naglakad na lang kami.

5. Wives can be loving, supportive, and caring companions to their spouses.

6. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

7. The task of organizing the event was quite hefty, but we managed to pull it off.

8. Wala naman sa palagay ko.

9. Bumili si Andoy ng sampaguita.

10. Hindi maikubli ang panaghoy ng bata habang nilalapatan ng lunas ang sugat niya.

11. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

12. Pupunta ako sa Iloilo sa tag-araw.

13. Tuluyan na siyang pumasok ng kwarto at isinara yung pinto.

14. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

15. Sa wakas sinabi mo rin. aniya.

16. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

17. Napangiti ang babae at umiling ito.

18. Kevin Durant is a prolific scorer and has won multiple scoring titles.

19. Påskelørdag er dagen, hvor Jesus lå i graven, og der afholdes ofte en stille og reflekterende gudstjeneste.

20. Driving fast on icy roads is extremely risky.

21. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

22. At sa paglipas ng panahon, naging malakas na ang lalaki na nakilala nilang Damaso.

23. Practice makes perfect.

24. Limitations can be overcome through perseverance, determination, and resourcefulness.

25. Napakagaling nyang mag drowing.

26. Kapag may isinuksok, may madudukot.

27. Sa kanilang panaghoy, ipinakita nila ang tapang sa kabila ng matinding pagsubok.

28. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

29. Bakit siya pa yung kelangan mong pahirapan?

30. Iyon hong hinog na mangga. Magkano ho?

31. The United States is the third-largest country in the world by land area and the third most populous country in the world.

32. Biglang dumating ang araw ng kanyang pagsusulit, naging abala si Nicolas sa kanyang pag-aaral kaya hindi siya nakakasulat at nakakadalaw sa dalaga.

33. Bumili sila ng bagong laptop.

34. Payat na payat na ang ama't ina niya para matustusan ang kanyang pangangailangan.

35. Gusto kong malaman mo na may ganitong pakiramdam ako, kaya sana pwede ba kita ligawan?

36. La voiture rouge est à vendre.

37. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

38. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

39. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

40. Noong una, sinasagot niya ang mga panunuksong ito.

41. Makakarinig ka ng halinghing sa gym, lalo na kapag may nagta-training ng cardio.

42. Sa kanyang pag-aaral ng sining, pinagmamasdan niya ang mga obra ng mga kilalang pintor.

43. Biglang kumaripas ng takbo ang magnanakaw nang makita ang mga pulis.

44. Hindi ako sumang-ayon sa kanilang desisyon na ituloy ang proyekto.

45. Naririnig ko ang halinghing ng mga kalahok sa obstacle course race.

46. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

47. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

48. Maririnig mo ang kanyang halinghing kapag sumasakay ng bisikleta sa mababang gear.

49. Nakatanggap kami ng masamang balita na ang aking kaibigan ay nawala at ito ay lubos naming ikinalulungkot.

50. Det kan være svært for transkønnede personer at finde støtte og accept i deres familie og samfund.

Similar Words

communications

Recent Searches

granlipadcommunicationbefolkningensurveyspusobringinglakadkontingtaposprutasngisidulottatanggapinayawfulfillingnahihilojuniofertilizerkanginapelikulamasayahinisinaramaluwangnapaluhaeksempelcarebabesobservation,sumindipakakasalannapabayaancornersmagkikitalandasplacekikitaindiacommercialgirlhospitalcarscountryfriendsmatangumpayiligtasnagtataaspinakamatapatfreelancerduonnakapagreklamonakangisikinikitakatapatpanghihiyangbuhokwestkumaripasmatamismedya-agwalaki-lakinauliniganlungsodrimastraditionalkagabihanapinnakapasabighanimarasigandyipnilordniyoabutanalagangangkanconsiststotahananhinihintayambisyosangjingjingboholnapagcantobalitaperformancemaaringisinaboynaliligodipangkumitahydelnagbabakasyonviolencepaki-ulittelaroommagbayadnagagandahanmaliitinabutancontent,sahigkasoexcitedfigurehila-agawanthereiwananmangingisdatalentednagbentakumbentobiglapumatolanimoykakainincollectionsgulangmaabutanpasliteachinternatanimpyestazoomstatingnagginglinawpulissarilinghidingrequirelumuwasnerissanaghinalakakayanangharapstrugglediniuwidadnagwalisisipprogramanalugmokmangeclassmatecorrectinglabananmrsrebolusyonwifisafenamingipanghampassalitangtinataluntonipinambilipupuntahanlapatanghelgrammarpintofarmsinalansanatindahilnakakulongmahinognamelockdownhadbokbasahanmagkaroonibonmarahiltayohinanappadabogmahabaislabehindactivitybingbingpagkuwangreateripinikitrenombrenangapatdanjolibeesteerabeneutilizainuminnapadpadginawaranherramientakan