Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "o-online"

1. Amazon started as an online bookstore, but it has since expanded into other areas.

2. Bilang paglilinaw, ang pagpupulong ay gaganapin sa online platform, hindi sa opisina.

3. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

4. Det kan omfatte spil som kasinospil, lotteri, sportsbetting og online spil.

5. I discovered a new online game on a gaming website that I've been playing for hours.

6. Ikinagagalak kong makilala ka sa personal pagkatapos ng maraming taon ng pagkakaibigan online.

7. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

8. Investors can purchase shares of stocks through a broker or online trading platform.

9. Keep in mind that making money online takes time, effort, and patience

10. Mag o-online ako mamayang gabi.

11. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

12. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

13. Online gambling er blevet mere populært i de seneste år og giver mulighed for at spille fra komforten af ens eget hjem.

14. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

15. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

16. Online traffic to the website increased significantly after the promotional campaign.

17. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

18. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

19. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

20. Sa ganang iyo, mas epektibo ba ang online classes kaysa sa face-to-face na pagtuturo?

21. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

22. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

23. The platform has also been criticized for promoting harmful content and contributing to online bullying.

24. The platform has implemented features to combat cyberbullying and promote a positive online environment.

25. The website's online store has a great selection of products at affordable prices.

26. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

27. Today, Amazon is one of the world's largest online retailers.

28. Tumingin ito sa mga website ng mga bagay na pwedeng bilihin online.

29. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

Random Sentences

1. Les personnes endettées peuvent se retrouver dans une situation financière difficile.

2. Magkano ito?

3. Bagaimana bisa kamu tiba-tiba hilang begitu saja? (How could you suddenly disappear like that?)

4. Aling lapis ang pinakamahaba?

5. She has just left the office.

6. Gusto kong magbasa ng libro, datapwat hindi ko alam kung anong libro ang pipiliin ko.

7. Omelettes are a popular choice for those following a low-carb or high-protein diet.

8. They are running a marathon.

9. Hindi siya naging maramot at inialay ang kanyang huling barya para sa donation drive.

10. It is important to have clear goals and expectations in the workplace.

11. Ihamabing o kaya ihalintulad ang isang bagay sa ibang bagay

12. Nag-umpisa ang paligsahan.

13. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

14. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

15. May bago ka na namang cellphone.

16. Si Hidilyn Diaz ay ang unang Pilipinong nakapag-uwi ng gintong medalya mula sa Olympics.

17. El actor hizo un comentario controversial que está llamando la atención de los medios.

18. They have been friends since childhood.

19. Sa isang tindahan sa may Baclaran.

20. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

21. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

22. Nosotros preparamos una gran cena para celebrar la Nochebuena.

23. The elderly are at a higher risk of developing pneumonia.

24. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

25. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng stress dahil sa kanyang rational thinking.

26. Hindi na nga nakatindig si Aya at sa inis nito ay gumapang patungong hagdanan.

27. Gusto ko hong gumawa ng reserbasyon.

28. Ibinigay ko ang aking panahon at atensyon sa pagtitiis ngayon upang makamit ang magandang kinabukasan.

29. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

30. Pwede ba kitang tulungan?

31. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa mga tao sa paligid natin.

32. We need to calm down and not let this become a storm in a teacup.

33. Sa Manila Hotel ka titigil, hindi ba?

34. Limitar la ingesta de alcohol y cafeína puede mejorar la salud en general.

35. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

36. Pupunta ako sa Madrid sa tag-araw.

37. Aerob træning, såsom løb og cykling, kan forbedre kredsløbets sundhed og øge udholdenheden.

38. Les écoles offrent une variété d'activités parascolaires telles que le sport, la musique et le théâtre.

39. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

40. She has adopted a healthy lifestyle.

41. The company launched a series of new products, targeting different customer segments.

42. Nagtatrabaho ako tuwing Martes.

43. Nagtanghalian kana ba?

44. Kumain ako ng macadamia nuts.

45. Sa panahon ng pandemya, maraming tao ang naging nag-iisa dahil sa lockdown.

46. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng kaguluhan at kalituhan.

47. Kumukulo na ang aking sikmura.

48. Remember that the most important thing is to get your ideas and message out to the world

49. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

50. Ano ang paborito mong pagkain?

Recent Searches

sasakyantotoongnailigtaso-onlinemakulongnagbantaysagasaankisssettingmagbubukidfaktorer,neveribaliknapakatagalmakapangyarihanmag-aralshocktuwangsumalakayconsuelonagliliwanaglotpinagsanglaanpusatwitchcountlessnanggigimalmalanongmakakawawalarangannaglokonapansinamuyinnagsilapituniversitypatayarguerhythmikinabubuhaytumatakbopaungolpinauwibumaligtadmusicaleskapintasangpanindaintensidadipinatawagadangnilanag-uwingpuntadiningapollomakakabaliknakamitsnanapatulalabawavenuskamotebutihingnasiyahanhawakaniniresetaespigaslilipadtsismosalever,business:nagtaposnakaakyatkangitansugatanghahahagumigisingkinabubuhaynagpakitapamburamississippilayasipinagbilingpaninigasallergyposporoseparationnapakabilisfireworkssumarapdoesmathpasalubongundasipinagbabawalsegundoinakalanghinagud-hagodproductsalagangdollylumiitmakalabasdeterminasyonililibretumugtogrimaspaangnagkasunogherramientamatandangnuevosnapagsilbihanmaluwaguniversitiespasasalamatmakisuyosarisaringnagpapantalleaderssunud-sunodkoreanagbibigayanadvancementseryosongmasrocknapakatataasbanlagku-kwentaundeniablenapasigawhatinggabiadvertisingmaawaingmasungitpackaginghanapinbayadchristmascommunicatediagnosticnanghihinamadmakapagpigilitinuroshadespag-irrigateheidaladalalcdfurynakaramdaminiangatkinilignochesmilemusiciansnaglinisthoughnapakonakapasabarangayentertainmentbutoganyanumokaylayuankaybiliskainanpamangkinmangingisdatarapangyayaringdeletingparticipatingmagbaliktiningnanstartdiferentespagbubuhatanencompassesthumbslilylistahanfittinikkirotsinenutrientsinfluencesanghelmagdidiskokasamahuwebesmakulitwinsnapakamisteryosonagpasamaimpact1990