Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "o-online"

1. Amazon started as an online bookstore, but it has since expanded into other areas.

2. Bilang paglilinaw, ang pagpupulong ay gaganapin sa online platform, hindi sa opisina.

3. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

4. Det kan omfatte spil som kasinospil, lotteri, sportsbetting og online spil.

5. I discovered a new online game on a gaming website that I've been playing for hours.

6. Ikinagagalak kong makilala ka sa personal pagkatapos ng maraming taon ng pagkakaibigan online.

7. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

8. Investors can purchase shares of stocks through a broker or online trading platform.

9. Keep in mind that making money online takes time, effort, and patience

10. Mag o-online ako mamayang gabi.

11. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

12. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

13. Online gambling er blevet mere populært i de seneste år og giver mulighed for at spille fra komforten af ens eget hjem.

14. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

15. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

16. Online traffic to the website increased significantly after the promotional campaign.

17. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

18. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

19. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

20. Sa ganang iyo, mas epektibo ba ang online classes kaysa sa face-to-face na pagtuturo?

21. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

22. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

23. The platform has also been criticized for promoting harmful content and contributing to online bullying.

24. The platform has implemented features to combat cyberbullying and promote a positive online environment.

25. The website's online store has a great selection of products at affordable prices.

26. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

27. Today, Amazon is one of the world's largest online retailers.

28. Tumingin ito sa mga website ng mga bagay na pwedeng bilihin online.

29. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

Random Sentences

1. Ang monumento ni Mabini ay matatagpuan sa may lalawigan ng Batangas.

2. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

3. Eto namang si Kuya di na mabiro! Bagay na bagay kaya kayo!

4. Ang poot ay isang pusong nasaktan na lumalaban upang mabawi ang dangal at dignidad.

5. Limitations can be financial, such as a lack of resources to pursue education or travel.

6. Different types of work require different skills, education, and training.

7. Jagiya? hinde parin siya umiimik, Ya Kenji.

8. Napansin ni Mang Kandoy na ang dugo ng diwata ay puti.

9. Amazon started as an online bookstore, but it has since expanded into other areas.

10. Mi esposo y yo hemos estado juntos por muchos Días de San Valentín, pero siempre encontramos una manera de hacerlo especial.

11. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

12. Masyadong matarik ang bundok na kanilang inakyat.

13. Hindi maganda ang amoy ng damit kung hindi ito maayos na naglalaba.

14. Kanina pa kami nagsisihan dito.

15. This has led to increased trade and commerce, as well as greater mobility for individuals

16. Sa sulok ng kanyang kaliwang mata'y nasulyapan niya ang ina.

17. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

18. Nag-iisa siya sa buong bahay.

19. Malilimutin si Ana kaya lagi niyang nakakalimutan ang kanyang susi.

20. Sa ganang iyo, dapat bang manatili sa kanilang posisyon ang mga opisyal na hindi epektibo?

21. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

22. Ilang taon ka tumira sa Saudi Arabia?

23. Ang kalayaan ay hindi dapat nakasira sa kapakanan ng ibang tao.

24. Ano ang ikinagalit ng mga katutubo?

25. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

26. Tolong jangan lakukan itu. - Please don't do that.

27. Nag-email na ako sayo kanina.

28. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

29. The symptoms of pneumonia include cough, fever, and shortness of breath.

30. Ang mga halaman ay dapat na pinapakain sa regular na may compost o fertilizer upang matiyak na sila ay may sapat na nutrients para sa paglaki

31. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

32. Bumalik siya sa Pilipinas nang biglaan dahil may emergency sa kanilang pamilya.

33. The website's loading speed is fast, which improves user experience and reduces bounce rates.

34. Le travail est une partie importante de la vie adulte.

35. Pumupunta ako sa Negros tuwing Abril.

36. Awang-awa ang maraming katutubo sa pagpapasan sa krus si Padre Novelles.

37. Emphasis can be used to provide clarity and direction in writing.

38. Inakala nga noon ng mga magulang na hindi na magkakaanak dahil matanda na ang kanyang ina pero isinilang parin siya.

39. Pinagkakaguluhan lamang tayo ng mga tao rito ay wala namang nangyayari.

40. She has been running a marathon every year for a decade.

41. Maraming lumabas na balita ukol kay Pangulong Manuel L. Quezon.

42. Smoking is a leading cause of preventable death worldwide.

43. Teka, pakainin na muna natin sila. ani Jace.

44. Ang tarangkahan ay gawa sa matibay na kahoy at bakal.

45. Nagtatrabaho ako sa Mimosa Family Home.

46. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

47. Nais nating makamit ang ating mga pangarap upang magkaroon tayo ng mas magandang buhay.

48. He is not painting a picture today.

49. Ang yaman naman nila.

50. Hinugot ko ang papel sa loob ng envelope.

Recent Searches

o-onlinekamiasmagtigilmagbaliknaiilangnaiisipjuegosistasyonkumakainartisttagaytaypagkaangatnapapansintotoongpagamutansittingnearmaasahangiyeranagsinemiyerkulesnamumulabalahibokommunikerermabatongpeopleestasyontemperaturasiksikanumiisodkontratasapatosnapiliminatamiskesoapelyidonabuhaypaninigaspicturesiiwasankampeondiyaryokanyanakakaanimautomatiskevolucionadoalisshocksellnalangnagbibigayanna-curiousnabasadepartmentsamantalangwriting,libertysementongproducererbinuksanmalalakiiikutanamuyinniyopapuntangpananakitpisarauwakisinalaysaycantidadconvey,natatanawoperativosnatutulogcynthiamanakbonasunogtumindiggubatreorganizinguniversetkinakailangangjolibeelumbayiiyakeconomicvegaslakadhanapinnanigasisinamafollowednagsimulalutuinvitaminsunud-sunodpinaulananbulaklakmatutonginspirationarabiacalidadbumangoneleksyonhumigakaniyalubospinoyitinulosmahigpitkataganglilikobantulotmatangumpaydealasiakainisisinumpamaniladustpanshoppingkinapagkaingmabutitiyanipagmalaakimarietondobirdstibokinalagaanbinanggajuankulotbumilibrasotsuperwaitersellingtagaroonpagkatmaayoskenjisakimparehaspanigkumpunihinburolkinantatoymarmaingmeroneducationmalikotaminnatalongiskedyulstockslistahanautomationenergipuedenbateryanasabingsonidopalapithdtvscottishmedidaparkingnagdarasalskypebilibelectoralsetyembrekaarawanhverchavitpedrokwebangbaticriticsdisappointkatabingdalawparagraphsmightabrilandamingisipdoktorsukatparisukatnapapalibutannapakalakidesigninganonglamesacarriedcamp