Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "usuario"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Gaano ka kadalas nag-eehersisyo?

2. Kalong nito ang kanyang kapatid na bunso.

3. Ibinigay niya ang kanyang panahon upang magbigay ng kaunting kasiyahan sa mga taong malungkot.

4. All these years, I have been blessed with the love and support of my family and friends.

5. Sa wakas sinabi mo rin. aniya.

6. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

7. May malawak na lupain ang kanyang mga magulang.

8. El puntillismo es una técnica de pintura que utiliza pequeños puntos de color para crear la imagen final.

9. Ang pamilya ang sandigan sa oras ng kagipitan.

10. Lumampas ka sa dalawang stoplight.

11. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong mayroong mga pangarap at mga layunin sa buhay.

12. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

13. Pwede ba akong pumunta sa banyo?

14. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

15. Masakit ang ulo ng pasyente.

16. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

17. He listens to music while jogging.

18. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

19. Ang pakikinig sa mahinahong agos ng ilog ay nagbibigay sa akin ng isang matiwasay na pakiramdam ng kalma at katahimikan.

20. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

21. The United States has a system of government based on the principles of democracy and constitutionalism.

22. Gelai, siya si Tito Maico. sabi ko sabay turo kay Maico.

23. En invierno, se puede disfrutar de hermosos paisajes cubiertos de nieve.

24. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

25. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

26. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

27. Después de estudiar el examen, estoy segura de que lo haré bien.

28. Samahan mo muna ako kahit saglit.

29. Me siento cansado/a. (I feel tired.)

30. Nahihilo ako dahil masyadong mainit ngayon.

31. There are a lot of benefits to exercising regularly.

32. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

33. Hay muchas hojas en el jardín después de la tormenta.

34. Owning a pet can provide a sense of purpose and joy to people of all ages.

35. Mabuti pa sila, nakikita ang masayang paligid.

36. Kinaumagahan ay wala na sa bahay nina Mang Kandoy si Rabona.

37. Matapang si Andres Bonifacio.

38. Some limitations can be temporary, while others may be permanent.

39. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

40. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

41. Inflation kann auch die Sparquote verringern, da das Geld weniger wert wird.

42. Ang saya saya niya ngayon, diba?

43. Ang laki ng sawa na kanyang nakita.

44. Alam mo ba kung nasaan si Cross?

45. Sa Chinese New Year, ang mga tao ay naglalagay ng dekorasyon na may pulang kulay bilang simbolo ng kapalaran.

46. Ang aking kabiyak ay ang aking kaligayahan at kabuuang kaganapan sa aking buhay.

47. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

48. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng stress at pagkalungkot.

49. Pahiram ng iyong sasakyan, wala akong ibang masasakyan pauwi.

50. Paano po pumunta sa Greenhills branch?

Recent Searches

usuariobringliligawansiyangpaglingonpalasyosarisaringbilihinlolaumangatkapataganmakilalatradisyonkahitnagsimulaunconventionalnakakapuntalagaslasginoongescuelasipinansasahognanigastusonggawingmatutonghinintaypalapagsandalingumibigalagakaniyanapakamaghatinggabiawitinbibilhinnasanchickenpoxlarongcarlosilyamarangyanginvitationsinenegosyojuanmaariguhitburmalendingcapitalmassesmukabasahinisangokaymasaktanloribotehumanoibaliksparkbernardomesangmodernaywanfeedback,pagviewsallscheduleballnutrientescoaching:naritofansbelievednagreplymapuputicornersbilhanseguridadbakantedoondebatesthoughtsaggressioncigaretteinterpretingconsiderarofferdonchambersmessagedevelopmentmediumpublishedconditionbilingtechnologiesrepresentedimpactednapabalikwasfurybuwanbumababanaglokohanplatformsmatangkadfranciscocomunicarsedisappointpakilagaynapansinumaagostshirtindiajobsevensoccerfullkapilingkuwebanapakabagali-markbotantekeepingkabighaeconomyfavormariokontinentengsenadorhigitmagta-trabahorevolutionizednagdaosmagkikitamaipantawid-gutommagpa-picturenaggingmagbasabanalpakikipaglabanmakipag-barkadapinapasayamaglalakadnananaginippagpasensyahannag-iyakanmakapangyarihanincluirnakayukominamahaltungawmakukulaysumusulatnasasabihandekorasyonhinimas-himasxviichristmassandwichnationalkainitanbarrerasgalaanginagawasay,principalestemperaturahinihintaymaintindihankolehiyosiksikanmamalaskulungannangagsipagkantahangawainmilyongproducenakitulogbumaligtadnaglutoalas-dosvarietyberetikutsaritanglilikotelephonenagpasanbiglaanbuwayainintaygabikakayananangkopbulongbutivelfungerendedasal