Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "usuario"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Hinayaan ko siyang tulala sa kanyang pag-iisip bago ko siya kausapin.

2. Ang daming adik sa aming lugar.

3. Danske virksomheder, der eksporterer varer til USA, har en betydelig indvirkning på den amerikanske økonomi.

4. The airport was busy, and therefore we had to arrive early to catch our flight.

5. Ipanlinis ninyo ng sahig ang walis.

6. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

7. Marahil ay nasa kabilang dako ng mundo ang taong mahal mo kaya't hindi kayo nagkikita.

8. Hala, change partner na. Ang bilis naman.

9. Facebook Marketplace is a platform where users can buy and sell items locally.

10. He has bigger fish to fry

11. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

12. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

13. Ibinigay ng titser ang libro sa estudyante.

14. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

15. Ang marahas na paggamit ng teknolohiya, tulad ng cyberbullying, ay dapat itigil at parusahan.

16. En el legado de Da Vinci se encuentra una gran cantidad de cuadernos y dibujos de sus estudios.

17. Ang kamalayan sa mga sintomas ng kalusugang pang-mental ay maaaring makatulong sa agaran at tamang pangangalaga.

18. Wag kang magtatanim ng sama ng loob sa kapwa.

19. Les employeurs recherchent des travailleurs fiables et ponctuels.

20. Anong klaseng karne ang ginamit mo?

21. Ano ang nasa tapat ng ospital?

22. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

23. She has been cooking dinner for two hours.

24. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

25. Hindi ko ho makain dahil napakaalat.

26. En el siglo XIX, el Romanticismo español tuvo un gran impacto en la música, con compositores como Isaac Albéniz y Manuel de Falla

27. Naghihinagpis ang ina sa pagkamatay ng kanyang anak na nauwi sa isang aksidente.

28. You have to push yourself to the limit if you want to succeed - no pain, no gain.

29. A couple of photographs on the wall brought back memories of my childhood.

30. Le stress et l'anxiété peuvent également avoir un impact négatif sur la motivation.

31. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

32. Sa bawat pagkakataon na pinagmamalupitan ako, lumalaki ang poot sa aking puso.

33. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

34. Hey! Wag mo ngang pakealaman yan! sigaw ko sa kanya.

35. There are a lot of benefits to exercising regularly.

36. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

37. Makikipag-dueto si Maria kay Juan.

38. In the early days, telephones were connected to a central switchboard, which connected calls manually

39. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

40. Nationalism can be a source of conflict between different groups within a nation-state.

41. Ang pagkakaroon ng sapat na kaalaman at impormasyon ay nagpapawi ng mga agam-agam at kawalang-kasiguruhan.

42. Anong tara na?! Hindi pa tapos ang palabas.

43. May basa ng dugo't lupa ang kanyang nguso.

44. El agricultor cultiva la tierra y produce alimentos para el consumo humano.

45. Naglalaro kami ng 4 pics 1 word sa cellphone.

46. Kumusta ang bakasyon mo?

47. May luha nang nakapamintana sa kanyang mga mata at ang uhog at laway ay sabay na umaagos sa kanyang liig.

48. L'intelligence artificielle peut être utilisée pour prédire les résultats des élections et des événements futurs.

49. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

50. Women have a higher life expectancy compared to men, on average.

Recent Searches

usuarionagpanggapkabiyakkaraniwangibilinangingitngitcreditgatasseniorindustryfatherkahilinganlihimnahantadtherapybarriersupobabestradepublishedendadaptabilityadgangscheduledulaavailablepanayinternalmaaringgawaingmakasalanangnakamitindividualsumabottalefeelinspirasyontamangprosesohanggangnakaluhodherramientasseguridadpersonalnilulonkakahuyanlunashappenedpinagbubuksanmagpa-picturerecordedmedicinekaloobangpagpapakilalapaghuhugasbaku-bakongimprovednakapapasongskypekinasilbingluluwasburmaisinagotlumbayentrekadalagahangnamulatpaga-alalanagkitadi-kawasamanakbonaiilagankaliwangaywantag-arawkamakailandadalawinmagkaibamahiwagangtechnologypapayapresidentialnapansintinahaksalamatlumalaonmangahassundalomananakawpagtinginnegativemakikitulogkatuwaanngunitisasamaorkidyasnagyayangpuntahansisikatmagbibiladgasolinasakaygymvarietynakabaondescargarlalargaipinaalamklasengplasanakakagalinganakriskalalongmangingibigbinawidaladalalamannagpuntakelanlegacysteamshipspasigawkinakaligligprogramsbroadcastsbinilingconteststillmadamishowsdulopolonaglalarolumungkotditocarlolockdownpawishumanngpuntakwebaprobinsyaunderholderkagandahanactualidadevenjackztantananmagbagoexcuselangkayhila-agawandurantepabalikapphumalosalitangpabalanginspirationphilosopheredsapaglingonsupilinkumirotnagsisigawmanonoodmangyaripatricknapatawadkumukuloikinakagalitnamumutlanaiyaknagmungkahipalabuy-laboyinakalangheartbreakpinagpatuloytoncualquierkaninumanpabulongtiktok,pilipinasisinuotnasilawnaguusapperpektingnewspagbebentagabedefinitivoalassinungalingrestawrancantidaduncheckedmaya-maya