Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "usuario"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Pang-isahang kuwarto ang gusto niya.

2. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

3. Ano ang binibili namin sa Vasques?

4. La Navidad y el Año Nuevo se celebran en invierno.

5. Lahat ay nagpasalamat sa nagawang tulong ni Tarcila at nakiramay rin sila sa sinapit ng mga anak nito.

6. How I wonder what you are.

7. Ang saya saya niya ngayon, diba?

8. Oscilloscopes display voltage as a function of time on a graphical screen.

9. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

10. Ngumiti siya ng malapad sabay hagikgik.

11. Halatang takot na takot na sya.

12. Siya ay laging nagmamalabis sa pag-aaksaya ng pera para sa mga luho.

13. Sa bawat panaghoy ng mga ina, umaasa silang magkakaroon ng katarungan ang kanilang mga anak.

14. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

15. Ice for sale.

16. The Niagara Falls are a breathtaking wonder shared by the United States and Canada.

17. Don't worry about making it perfect at this stage - just get your ideas down on paper

18. My husband surprised me with a trip for my birthday, and I couldn't be happier.

19. Tumayo na ko tapos pumasok sa kwarto ko.

20. Nang simula ay hindi napuputol ang komunikasyon ng magkasintahan, araw araw na sumusulat ang binata sa dalaga at ganoon din naman ang dalaga.

21. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

22. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

23. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

24. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

25. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

26. Emphasis can be used to create rhythm and cadence in language.

27. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

28. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

29. Naniniwala ka ba sa legend ng academy?

30. Si Pedro ang tatay ko at siya ang nanay ko.

31. Anong kulay ang gusto ni Andy?

32. Alam ko pede kang mapagkatiwalaan, Peppy. Kaya please?

33. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

34. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

35. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

36. El Día de San Valentín es una festividad muy popular en muchos países.

37. Hinde ka namin maintindihan.

38. Si tienes paciencia, las cosas buenas llegarán.

39. Ang magnanakaw ay nakunan ng CCTV habang papalapit ito sa tindahan.

40. Many people go to Boracay in the summer.

41. La tos seca es una tos que no produce esputo o flema.

42. If you keep cutting corners, the quality of your work will suffer.

43. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

44. At sa kanyang paglayas, naligaw siya sa gubat at inatake ng maraming alamid.

45. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

46. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

47. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

48. Hendes ansigt er som et kunstværk. (Her face is like a work of art.)

49. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

50. At følge sine drømme kan føre til stor tilfredsstillelse og opfyldelse.

Recent Searches

usuariolondoninilistamanirahanlaruinnaghilamosskirtlucywesternmagalitkabighapinansindiferentesguerreropalasyominerviesurveysbarrerasginawangkarapatanglilikobibilimaramothunihinampasnuevohinahaplosantesandreabumagsaksahodmagbubungaagossamupetsamagbungaphysicalbinabaanvedforcesmapuputihallpagkalapitguidanceallottedpulitikoanongprosesoahhhhprobinsyabirdsnewspapersmaghintayanilapangakovoresbernardoklasengkatapatayawrisekindsngisiasiatickriskaaumentarlasaricocareerseniormanuksogranadaltohmmmadobonahihilokarapatanmaibalikiyanpakpakfridayreducedtherapygalitatinoliviafurytools,janehumanobatinerissaimpitkitrepresentedtraininggeneratemetodeendmichaelfigurecrosspagtataposstuffedputiresultkararatinggamitnuclearaddageconventionaldragonfloorsequeandroideithermaratingrequirepracticesbackmediumtypesstartedhugismusicnaka-smirkfarmagkaibaelectroniclalakinglasnag-aagawanaplicarcynthiatiyankasalananmalamangimulataccessrelyipagbililorenareplacededadleytealintuntuninnaibabafeedback,organizehatingcommercekababayanspecificgloriaagadindividualelectedoftennananaginipwhybecomes1960swaaamatatalimmagtatamposweetahasnangingisaykarnabaltenidoyeheytelangnoobroadcastsbukodmaarilagispare1954kaganda1920smerrygenerositycarbonrepresentativeskesopaligsahanmaabutannagsamatilgangmagtatakatig-bebeintenasaanritopakainmulighedseekmagsinunod