Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "therapeutics"

1. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

Random Sentences

1. Pinagpalaluan ang Kanyang karunungan.

2. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

3. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

4. Pneumonia is a serious infection that affects the lungs.

5. They have been studying science for months.

6. Wala na ang beyblade at ang may-ari nito.

7. Nasa harap ng pinto ang dalawang aso.

8. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

9. Ang mga bayani ay nagtutulungan upang maipagtanggol ang bayan laban sa mga banta at kahirapan.

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. Hindi ako pumayag na hiramin ang aking laptop sa aking kapatid dahil baka masira ito.

12. Arbejde er en vigtig del af voksenlivet.

13. Marahan niyang inalis sa pagkakakawit ang mga balde.

14. Limitations can be a result of fear or lack of confidence.

15. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

16. Videnskab er systematisk undersøgelse af natur og universet ved hjælp af metoder som observation, eksperimentering og analyse

17. Beast. sabi ko pagkalapit sa kanya.

18. Ano ang ikinagalit ng mga katutubo?

19. Terima kasih banyak! - Thank you very much!

20. Ano pa ho ang dapat kong gawin?

21. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

22. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

23. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

24. Sinuspinde ng pulisya ang operasyon sa paghuli ng salarin dahil sa kakulangan ng ebidensiya.

25. Obvious. tawa nanaman sya ng tawa.

26. Elektronik kan hjælpe med at forbedre sikkerhed og beskyttelse af data.

27. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

28. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

29. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

30. El atardecer en el mar es un momento sublime que muchos aprecian.

31. Sa paligid ng bundok, naglipana ang mga ibon na nagpapaganda sa tanawin.

32. Gaano ka kadalas pumunta sa doktor?

33. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

34. Malapit na naman ang pasko.

35. Salatin mo ang upuan upang matiyak na tuyo ito bago ka umupo.

36. Dahil sa tagumpay ni Hidilyn Diaz, mas maraming Pilipino ang nagkaroon ng interes sa weightlifting.

37. El equipo de recolección mecánico es muy eficiente para cosechar grandes extensiones de tierra.

38. Put all your eggs in one basket

39. The acquired assets included a portfolio of real estate properties.

40. Kailan ipinanganak si Ligaya?

41. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

42. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

43. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

44. Sa isang tindahan sa may Baclaran.

45. Taman Safari Indonesia di Bogor adalah tempat wisata yang menampilkan satwa liar dari berbagai belahan dunia.

46. Hindi natinag si Kablan sa loob ng kanyang tindahan.

47. Panay pa ang post nito sa facebook ng bagong damit eh hiram lang naman nya ang lahat nang yun.

48. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

49. Naging tradisyon sa aming barangay ang nagiigib ng tubig para sa binyag ng mga sanggol.

50. Pumunta kami sa Cebu noong Sabado.

Recent Searches

therapeuticskainitannaiinisbayadkulturcanteenlumutangmagdaraosrenacentistapagguhitmahuhulisarongbarcelonagroceryxviisunud-sunodbusiness:hinalungkatparusahanmagselosika-50salatingrowthkutsilyoaguaflamencotamadtanawpalapagmaghatinggabimatangkadhumigaincitamenterkendiisamamatabangorganizemarangyangnoongsilyalaruandesarrollarself-defensebuhokthroatpatikastilalalamunanvehicleslapitanipapaputoldahanalexandervistsikotrenrenatodissepsssnanangismatipunolangkayvansakinbalingcongressorugagamot1000ultimatelyelitekadaratingpopularizefuelfideltuladniyangspendingani1973labanreservationanimoguestsfakebotemoodbumahaverden,visinterpretingetoheicigarettesutilcommunicationfuncionesfieldlackalindidgeneratenakahuglandoalignstooldeclareenterreadingbeforeuminomfredhimselfpossibleerrors,stringevolvedatacontroladulopacecompleteamountheftyseparationprimeraspakanta-kantangnaalisretirarnagibangiwasiwascourtinakalahomesmakisigtrasciendehinogtabinglumakingleadnanaloalas-dosshesalaminsinigangmagsabiumagangnandyanmalawakhalinglingmataasprovideaabotbentahanknownpatuloylimithomeworkdalandanbumiliallowedrobertnanunurileahpakisabiideyaitlogaltmagkakagustonahuhumalingmagsusuotrecordedumiisodspecialcommunicateallergyumaliskoryenteidiomainilabasanak-pawisingayentrepagkokakiniintayanimoyutaksanayjangabeavanceredenegativeipantalopotropinagsikapanlibagitemsfridayeranbeds