Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "popularize"

1. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

2. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

Random Sentences

1. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

2. Algunas serpientes, como la cobra real y la serpiente de cascabel, son conocidas por sus capacidades defensivas y sus venenos letales.

3. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

4. Natutuhan ng mga mag-aaral ang talambuhay ni Lapu-Lapu bilang isang bayaning lumaban sa dayuhang mananakop.

5. Halos nakalimutan na ng mag-asawa ang nangyari sa diwata.

6. The new restaurant in town is absolutely worth trying.

7. El agua es esencial para la vida en la Tierra.

8. Bakit di mo 'to sinabi sa akin?

9. Narito ang pagkain mo.

10. Isa sa paborito kong kanta ng Bukas Palad ay "I Will Sing Forever".

11. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

12. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

13. Ang daming kuto ng batang yon.

14. Nauntog si Jerome sa kanilang pintuan.

15. In 2010, LeBron made a highly publicized move to the Miami Heat in a televised event called "The Decision."

16. Hindi niya sinunod ang payo ng doktor, samakatuwid, lumala ang kanyang karamdaman.

17. Mayroong maraming tradisyon sa kasalan, tulad ng pagsusuot ng puting damit at paglalakad sa altar.

18. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

19. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

20. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

21. "Dogs come into our lives to teach us about love and loyalty."

22. El que mucho abarca, poco aprieta. - Jack of all trades, master of none.

23. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

24. Nakakapagod din palang maging nag-iisa sa paglalakbay.

25. Las plantas medicinales se utilizan para elaborar remedios naturales y tratamientos terapéuticos.

26. Bilang paglilinaw, ang damit na dapat isuot ay kulay puti, hindi asul.

27. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

28. Ngunit parang walang puso ang higante.

29. Omelettes are a popular choice for those following a low-carb or high-protein diet.

30. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

31. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

32. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

33. Sa mga pinagdadaanan natin sa buhay, kailangan nating maging handa sa agaw-buhay na mga pagkakataon.

34. Tinuro ng coach kung paano kontrolin ang bola habang tumatakbo.

35. Sa aming barangay, ipinamalas namin ang bayanihan sa pagtatayo ng bagong silid-aralan.

36. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

37. He forgot his wallet at home and therefore couldn't buy lunch.

38. spread information and knowledge from one corner of the globe to another.

39. Really? What is he doing sa tapat ng room natin?

40. Mi amigo y yo nos conocimos en el trabajo y ahora somos inseparables.

41. Kung ako si Maico? Malamang magwawala ako. aniya.

42. Bibisita ako sa lola ko sa Mayo.

43. Jeg kan ikke stoppe med at tænke på ham. Jeg er virkelig forelsket. (I can't stop thinking about him. I'm really in love.)

44. Making large purchases without consulting your budget is a risky move.

45. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakatotoo at magpakabuti.

46. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

47. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

48. Nang malamang hindi ako makakapunta sa pangarap kong bakasyon, naglabas ako ng malalim na himutok.

49. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

50. Sa aming probinsya, makikita mo ang mga bukid na mayabong na mga tanim.

Recent Searches

popularizedinistudentalerepubliclabinglegislativeeasierbranchestanimchoiceouedurirelativelyformainilingtiposderfatalipinadaratingresponsibledidingexpectationslearningconvertingwithoutneedsgitaragenerabaamazoncompletemultoipongmotionitongipaliwanagtungkodpulitikoeuphoricairconmagasintanawinagawtilafactoresparaimpactokagayasalaminincludenearnandoontulalanasasakupanpaki-chargecultivationi-rechargebulalasminervieilansusunduinhinahaploscandidatessultankayflerekaraokebusabusinathenamagaling-galinganagamesusapakainprobablementepetsainuminmastermoviespoliticalsportskomunikasyonmakitanagkakasyamagtanghaliankinagalitanmakangitikagandahagpatutunguhanpanalanginmedicinenageespadahannakikiahiwanahihiyangmagkaharapopgaver,makasilongtillnai-dialpuntahanumagawmagdaraosnasaanpagkainisnaiisipsalbahengmagtagopaligsahanniyogpaparusahanmaghaponnabuhaypagbibiroproducererpatakbongmarketingemocionaltusongincredibletulongnangingilidbirthdaysakyanmasayanatuyonuevobumagsakhinukaykatagangmalawakawitinrecibircreditgawanapapikito-orderparehassinakoppalakajoblihimstreetseparationpiginganihinsiglopangalanpublishing,matigasskyldesbigongkontingsalitangtalentkahilinganbigyanbutchareasbingbingwashingtonpaksajenarosellemoderndalandandisappointmerrydiagnosticnooadversebagyokalakingtradestrategystonehamdinmoodibalikglobaldolyarmamimisstomdebatesviewsstyleslockdownferrerbeinghitpartnerdaigdigtongbulongpistadilagmitigatebetarequire