Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "continues"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's legacy continues to inspire and influence scientific research today.

4. Einstein's legacy continues to inspire scientists and thinkers around the world.

5. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

6. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

7. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

8. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

9. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

10. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

11. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

12. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

13. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

14. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

15. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

16. Today, Bruce Lee's legacy continues to be felt around the world

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Diyan ang bahay ni Mr. Marasigan.

2. Claro, puedes hacer todas las preguntas que quieras.

3. Sa hatinggabi, naiiba ang itsura ng mga lugar kaysa sa araw.

4. Bakit walang pagsidlan ang tuwa niya?

5. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

6. Mayroon akong asawa at dalawang anak.

7. Sumakay kami ng kotse at nagpunta ng mall.

8. Ang mga kundiman ay bahagi ng ating kultura at nagpapaalala sa atin ng halaga ng pagmamahal at pag-ibig sa ating kapwa.

9. Kahit pagod ka na sa trabaho, nakakarelax ang paglalakad sa dapit-hapon.

10. Ang mag-aaral ay nagsusulat ng mga sanaysay at mga ulat bilang bahagi ng kanilang mga proyekto.

11. La creatividad es una habilidad que se puede desarrollar con la práctica y el esfuerzo.

12. Magmula noon nakilala na sa Palawan ang pating.

13. Mahal ko iyong dinggin.

14. Ang pagpili ng lugar ng kasal ay importante upang masigurong magiging maganda ang setting.

15. Les employeurs peuvent promouvoir la diversité et l'inclusion sur le lieu de travail pour créer un environnement de travail équitable pour tous.

16. Ano-ano ang mga projects nila?

17. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

18. Salamat na lang.

19. Despite the many advancements in television technology, there are also concerns about the effects of television on society

20. It can be helpful to create an outline or a mind map to organize your thoughts

21. Las hojas de papel se pueden reciclar para hacer papel nuevo.

22. Huwag magmadali, namnamin mo ang proseso ng pagkatuto.

23. Di pa namin napapag-usapan yan 'My.

24. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

25. Hindi niya gustong maging nag-iisa sa pagpaplano ng kanyang kinabukasan.

26. Hindi ko maaaring pabayaan ang aking mga agam-agam dahil ito ay maaaring magdulot ng panganib sa aking buhay.

27. Si Mabini ay naging pangalawang pangulo ng unang Republika ng Pilipinas.

28. Ako ay may kaugnayan sa iyo sapagkat ako ang nagbiyaya sa iyong mga magulang upang ikaw ay isilang dahil sa kanilang busilak na kalooban.

29. Los días soleados de invierno pueden ser fríos pero hermosos, con un cielo azul brillante.

30. Malapit na ang araw ng kalayaan.

31. Trenta pesos ang pamasahe mula dito

32. Sa bus na may karatulang "Laguna".

33. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

34. Nagtaas na nang pamasahe ang bus.

35. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

36. Naglalakad siya ng mabagal habang naka yuko.

37. Ang sugal ay isang hindi wastong paraan ng paghahabol ng pera at tagumpay.

38. Ang mga pasahero ay nagbigay ng kanilang mga mungkahi upang mapabuti ang karanasan sa paglalakbay.

39. Naka color green ako na damit tapos naka shades.

40. Håbet om at finde vores sande formål kan føre til stor personlig opfyldelse.

41. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

42. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

43. Magkano ang bili mo sa iyong cellphone?

44. Emphasis can be used to create rhythm and cadence in language.

45. Pasensya na, kailangan ko umalis ng maaga.

46. Sa kalikasan, mahalaga ang mga punong-kahoy dahil ito ang nagpapakain sa iba't ibang uri ng hayop at insekto.

47. La paciencia es necesaria para superar las pruebas de la vida.

48. She has been preparing for the exam for weeks.

49. Pabili ho ng isang kilong baboy.

50. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Recent Searches

continuesreturneddifferentconditionlasinggraduallyinvolvedigitalmasrolledahhpalitanpagkakataongverden,sensiblepasensyarelomananahiroleernanconditioningwaymagawangpaslitnabiawangnatutuwapinaulananpollutionhouseholdfauxpagmasdanginaganoonreportermagalingilocoslumutangdarkharapanrevolutionerethinatidpatienceothersspareparkepaskomapagbigaypilipinasgalitistasyonnakikitangbrancher,butikipagsasalitavidtstraktcualquiermaghaponisinagotmarketingnasaasopinoykanyalakaspagbabantakasaysayanpulismabaitlalakekumbentotibigmisteryonakasandigdekorasyonpodcasts,ikinakagalitnakakatawasulingantuwidbulsabelievedmalapitcomeinsteadattackcertainpilingbetaulingnapakahanganinongtinataluntonumagawsagutinmaintindihanmakawalacarmennobodymagpakaramikaliwamahalgasmenmenssikatpesonagsimulatayobihiranapilitangbalinganfederalcompletamenteadmiredpatientkargangtulangdumilimupuanfriendkinsesumigawcoalhopeaffiliatewasteiilansinumangdiscoveredlikestagalogmangedulotsenateanimoytsepanayminutosamfundbarnescryptocurrency:brieftenwestmadamimuchasproblemakumarimotfacebookbrucereservationcakenaggingnatingdaratingflyfacenalugodmakaiponaidtumalonbatok---kaylamignag-iimbitaafterpansamantalakinalakihangayundintwo-partymerrysamukaninorelativelybopolsnananaghiliespecializadasumagatuwang-tuwanagpapaniwalaikukumparaentranceinaabutannapipilitannagtataasnakadapamagtanghaliannakikilalanggratificante,kwenta-kwentanakakapasokmagpapabunotbooksaanhinmaglalarot-shirtpapagalitannakatirangkatawangpinasalamatanmahahaliktumatawagmagpalagoibinili