Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "continues"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's legacy continues to inspire and influence scientific research today.

4. Einstein's legacy continues to inspire scientists and thinkers around the world.

5. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

6. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

7. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

8. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

9. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

10. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

11. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

12. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

13. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

14. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

15. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

16. Today, Bruce Lee's legacy continues to be felt around the world

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

2. Nagreklamo ako tungkol sa pakete ko.

3. No puedo creer que ya te vas, cuídate mucho y no te olvides de nosotros.

4. Alay ko sa iyo ang bawat sandali ng buhay ko.

5. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

6. Adopting a pet from a shelter can provide a loving home for an animal in need.

7. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

8. Gusto ng mga batang maglaro sa parke.

9. Upang hindi makalimot, laging may sticky notes ang malilimutin na si Bea.

10. The uncertainty of the future can cause anxiety and stress.

11. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng tamang pag-iisip, kaalaman, at tiyaga.

12. B-bakit mo pinatay yung ilaw?! biglang tanong ni Cross.

13. The scientific method is used to test and refine theories through experimentation.

14. Si Ogor ang kanyang natingala.

15. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

16. Puwede ka ba sa Miyerkoles ng umaga?

17. Naalala niya ang itinuturo ng misyunero na si Hesus daw ay muling nabuhay pagkalipas ng tatlong araw

18. Nahulog ang bola sa dagat kaya lumangoy si Rico para kunin ito.

19. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

20. Ang pagkapanalo ng koponan ay siyang ikinagagalak ng lahat ng sumuporta sa kanila.

21. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

22. Ang kahusayan ng isang guro ay dapat na itinuring at kilalanin ng mga mag-aaral.

23. Disculpe señor, señora, señorita

24. Ano ho ang gusto niyang orderin?

25. Ang pagpapalitan ng mga bulaklak ay karaniwang ginagawa sa kasal.

26. Magtanim na lang tayo ng puno para makatulong sa kalikasan.

27. La comida tailandesa es famosa por su sabor picante.

28. I am not enjoying the cold weather.

29. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

30. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

31. Ang tunay na kayamanan ay ang pamilya.

32. Mathematics is an essential tool for understanding and shaping the world around us.

33. Alam mo ba kung bakit takot si Cross sa hospital?

34. The bridge was closed, and therefore we had to take a detour.

35. Si Apolinario Mabini ay kilalang bayani ng Pilipinas.

36. Gising ka pa?! parang nabigla nyang sabi.

37. She exercises at home.

38. El uso de drogas es un problema grave en muchas sociedades.

39. Ngunit wala siyang nararamdaman sakit.

40. Namilipit ito sa sakit.

41. All these years, I have been discovering who I am and who I want to be.

42. Nagdiriwang sila ng araw ng kalayaan.

43. Ang kamalayan sa kalagayan ng kalikasan ay nagtutulak sa atin na alagaan ito para sa susunod na henerasyon.

44. Merry Christmas po sa inyong lahat.

45. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

46. If you keep cutting corners, the quality of your work will suffer.

47. Habang wala pang trabaho ay matuto kang magtiis na asin ang ulam.

48. Lumayo siya sa amin, waring nais niyang mapag-isa.

49. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan kemauan untuk beradaptasi.

50. Ang aming angkan ay may natatanging kultura at mga paniniwala.

Recent Searches

kingipipilitpublishingpapuntacontinuesprogressmonitorbetaenterlasingableformatdatasetsgotannaipihitcommerceeviltuvotrafficisinaraamincebumensydelsernagbabakasyonvictoriaunahinalaganghagdankasoycomputersduonhospitalculturalamigzoomincreasedpagpuntakawalkiniligpaglalabadalayuninarabiangumingisinanunuriipantalopfeedback,kilalabibilibagyongitlogiintayinbinuksantinakasanfurideaunoanakiniintayrepublicanpagpapakilalapinakamatapathinipan-hipanmumurapagngitinagngangalangagwadornapaplastikanpangungusapmatesadaladalathroughouthiganteikinasuklampinaghatidankabuntisannabighaniromanticismohitanakakagalasasayawinnagkwentopinapasayanapaiyaksasabihinaksidentenagbiyayamagsunognakatulongmakikitanitongnapasubsobgumawapaki-ulitbwahahahahahamagtigilbeautymawawalaforskel,matulisubodvegasnamumukod-tangirequireharpnglalabakumanannagsilapitnakitulogsementeryomasyadongpagtatakagiyerainiuwimatandamarkliligawancoachingnatakotniyanfulfillmentnagbibigayannabigkaspaaralanisasamahinagistsismosanatitiyakkrusnakapasokproveterminoanokamotebirdsbulonghatinggabibibigyanrenaiabawatnanoodyamankaninahelenakinasuklamankwebabateryailagayo-ordermataaskulotkasakitincidenceexperts,eksportennapapatinginkenjiopographicdalawameaningdikyamlinawoutlinenagpuntanaggalathankfarmmatangplacebilinsinipangtonbokreboundbecomeaywancivilizationahitbangartslaylaycomplicatedprofessionalpedeoutemaillatedrayberjackysorrydogchadmuyclientesibabapopulationtil