Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "continues"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's legacy continues to inspire and influence scientific research today.

4. Einstein's legacy continues to inspire scientists and thinkers around the world.

5. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

6. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

7. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

8. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

9. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

10. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

11. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

12. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

13. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

14. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

15. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

16. Today, Bruce Lee's legacy continues to be felt around the world

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Party ni Lory? nabigla sya sakin sa sinabi ko.

2. Isang matandang lalaki naman ang tumikim sa bunga.

3. Gawan ninyo ng paraang makalabas po sana ako sa pagkakakulong ko sa loob ng prutas na ito.

4. Magkaiba man tayo ng landas ay tiyak kong magkikita pa din tayo.

5. The hotel room had an absolutely stunning view of the city skyline.

6. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

7. Inakalang nanalo siya sa laro, pero may mas mataas pa palang puntos ang kalaban.

8. Sa ganang iyo, tama bang ipagbawal ang paggamit ng plastik sa mga pamilihan?

9. The cake was so light and fluffy; it practically melted in my mouth.

10. Sa mga perya, naglipana ang mga tao na naghahanap ng libangan.

11. Ang pagbibigay ng oras at pag-aalaga sa mga alagang hayop ay nakagagamot sa aking kalooban at nagbibigay ng pagmamahal.

12. Naalala niya ang itinuturo ng misyunero na si Hesus daw ay muling nabuhay pagkalipas ng tatlong araw

13. "Let sleeping dogs lie."

14. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

15. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

16. These films helped to introduce martial arts to a global audience and made Lee a household name

17. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

18. The Twitter Explore tab provides a curated feed of trending topics, moments, and recommended accounts.

19. Ang kalayaan ay isa sa mga pinakamahalagang karapatan ng bawat tao.

20. En invierno, las temperaturas suelen ser bajas y el clima es más fresco.

21. She is not drawing a picture at this moment.

22. La paciencia es necesaria para alcanzar nuestros sueños.

23. Ngunit hindi inaasahang ang dadalaw pala sa kanya ay ang kanyang ama

24. Emphasis can also be used to create a sense of urgency or importance.

25. Agama juga sering menjadi landasan bagi hukum dan kebijakan di Indonesia, dengan prinsip-prinsip agama tertentu tercermin dalam sistem hukum negara.

26. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

27. Ang presidente ng Pilipinas ay nagpabot na ng ayuda sa mga mahihirap.

28. Nagkita kami kahapon sa restawran.

29. Hay muchas formas de arte, como la pintura, la escultura, la danza y la música.

30. Nous avons décidé de nous marier cet été.

31. Anong oras mo ako ihahatid sa airport?

32. Sa aking opinyon, isa sa mga magagaling na mang-aawit sa Pilipinas ay si Bukas Palad.

33. The doctor measured his blood pressure and diagnosed him with high blood pressure.

34. Nagsisilbi siya bilang public servant upang matugunan ang pangangailangan ng kanyang nasasakupan.

35. Ang lakas mo uminom wala ka naman ambag.

36. Los héroes son personas que enfrentan grandes desafíos y se levantan para superarlos.

37. Pupunta si Mario sa tabing-dagat sa hapon.

38. The cutting of the wedding cake is a traditional part of the reception.

39. Mabuhay ang bagong bayani!

40. Eine schlechte Gewissensentscheidung kann zu Konflikten und Schwierigkeiten führen.

41. Hindi ako usually ganto, pero sana pwede ba kita makilala?

42. Ayon sa doktrina ng Simbahang Katoliko, ang purgatoryo ay isang lugar kung saan ang mga kaluluwa ay nag-aayos bago pumasok sa langit.

43. The elderly are at a higher risk of developing pneumonia.

44. Marami ang nagpasalamat dahil hindi naging kamukha ng sanggol ang kanyang ama at ina.

45. Alam na niya ang mga iyon.

46. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

47. Puwede bang makausap si Clara?

48. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

49. Bumilis bigla yung tibok ng puso ko.

50. Ang tagpo ng nag-iisang bata sa lansangan ay nagdulot ng hinagpis sa aking damdamin.

Recent Searches

continuespasswordthereforenilangkinuhakangitantalinoimprovedpuntafeedbackmahuhuliregularmentecreationmuchnarininginfluencetwopublishedadaptabilitykasingskillawarehulingcountlessnotebookkagandanagkitamagtataaskahitalagangkalaunanpulanginloveisinaraprinceduonlansanganbanggainnaglokohanmakalaglag-pantytvsdistansyanakatirangnagbabakasyonnasusunoghagdannatitirapneumonianapaaabotvalleyloobresignationlegendsgranzoomkinukuyomlimituponnakapagngangalitairportcomunicarsereallyhistorymariagiyerakahongmanilbihantumalonmagpasalamattabingendelignakitahinipan-hipannamumuongsportsmedya-agwanagagandahansteamshipspinagtagpomayroongteacherpebreroreviewantoksapottamisfiverrlasinggeropagkalungkotmagsalitasponsorships,moodpinapasayanahawakannananaghilikagalakanmakitanagkakasyanapaluhakakataposkapasyahandaramdaminutak-biyaimporinirapanisasabaddesisyonanpagbabayadkinalakihanumuwimagbaliknandayamontrealbahagingnakangisinglumagoisinusuotbakanteisinaboyalas-dostumamakontratirangnaghubadkababalaghangsaktansuriinpaglingonliligawantowardskundikatulonghumiganabiglacreditrequierenteachingskinalalagyanlabing-siyamcandidatetiyasantoslihimstreetsayawanlangkaycampaignshinintaybulonginspiredbutchbinatakkahilinganmeronedsapangalanmentalinangfulfillingbanyohidingheheboracayailmentstradesignleadingareaslabingdrayberasinlatestsumindiilogclasesbairdmealconsideredbumugacomplicatedpedelabascanjackykaringmarkedbroadpinalakingserharmfultsaatrippasangoftenintelligencefacultyallowedpointbow