Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "continues"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's legacy continues to inspire and influence scientific research today.

4. Einstein's legacy continues to inspire scientists and thinkers around the world.

5. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

6. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

7. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

8. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

9. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

10. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

11. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

12. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

13. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

14. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

15. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

16. Today, Bruce Lee's legacy continues to be felt around the world

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Naalala ni Mang Kandoy ang abo ng puso ni Rodona na kanyang itinago.

2. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

3. Magandang maganda ang Pilipinas.

4. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

5. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

6. The guilty verdict was handed down to the culprit in the embezzlement trial.

7. Binuksan ko ang pintuan ng condo ko at binuksan ang ilaw.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

10. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

11. La labradora de mi cuñado es muy ágil y puede saltar obstáculos muy altos.

12. La paciencia nos enseña a esperar el momento adecuado.

13. Ang talambuhay ni Andres Bonifacio ay nagpapakita ng kanyang matatag na pagtitiis sa gitna ng mga pagsubok.

14. Hinugot niya ang lakas ng kanyang katawan upang maitulak ang sasakyan na nabangga.

15. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

16. Si Ogor ang kinikilalang hari sa gripo.

17. The website has a chatbot feature that allows customers to get immediate assistance.

18. A picture is worth 1000 words

19. Sa dakong huli ng deadline, nai-submit ko na rin ang aking project.

20. Hindi namin mahanap ang tarangkahan ng bahay mo kaya't nag-text kami sa iyo.

21. The weather was bad, and therefore the game was cancelled.

22. Spillene kan også være afhængige af held, dygtighed eller en kombination af begge dele.

23. Gusto ko na magpagupit ng buhok.

24. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

25. Einstein's ideas challenged long-held assumptions about the nature of space and time.

26. Napuyat ako kagabi dahil sa panonood ng k-drama.

27. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

28. Saan nagtatrabaho si Roland?

29. Malapit na ang araw ng kalayaan.

30. A lot of money was donated to the charity, making a significant impact.

31. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

32. A veces es difícil encontrar buenos amigos, pero cuando los encontramos, vale la pena.

33. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

34. Revise and edit: After you have a complete draft, it's important to go back and revise your work

35. Bakit wala ka bang bestfriend?

36. Ang pagkakaroon ng tamang kaalaman at kakayahan ay makakatulong upang maibsan ang pangamba.

37. Taga-Ochando, New Washington ako.

38. Los bebés pueden necesitar cuidados especiales después del nacimiento, como atención médica intensiva o apoyo para mantener la temperatura corporal.

39. Hinde ko alam kung bakit.

40. Saan ka nakatira? ang tanong ng pulis.

41. Les enseignants peuvent organiser des sorties scolaires pour enrichir les connaissances des élèves.

42. Les voitures autonomes utilisent des algorithmes d'intelligence artificielle pour prendre des décisions en temps réel.

43. Hindi ko alam kung may chance ako, pero ito na - pwede ba kita ligawan?

44. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

45. Laughter is the best medicine.

46. Nagbasa ako ng libro sa library.

47. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

48. Mas nagustuhan ko ang guro ko sa Musika kaysa sa dati kong guro.

49. Kapag ako'y nasa eroplano, natatanaw ko ang iba't ibang mga pook sa ibaba.

50. Natuto siyang lumaban sa kaniyang mga magulang.

Recent Searches

inomcontinueseditorwebsitepagkalungkotatentobecameencompassespalikurannecesariogitanaslalawiganmasayang-masayabumuhosvotesdiamondngayongangalkumulogmangyayarinakahigangmesalingidmakuhagabi-gabiconvertidashousemanparaangsiniyasatmamariladdinghimihiyawnagtagalpagtataposanghelnagtalaganagpasamasineupoinstitucionesbopolskakayanangbarangaykanilaboyfriendsakopydelserbunutan3hrskikopinakamahalaganggumagalaw-galawnagbanggaanmakikipag-duetopagpapatubonagpapaigibnagmungkahinagkakakainregulering,nakatulogpinuntahanmagkaibigankwenta-kwentakinapanayammakangitidiscipliner,kumalmalandlinehayaankasintahanbayawaknandayapakikipagbabagpangyayaripagdudugodiyaryonakataasmagagamitnangapatdannakatitignakabluenavigationmagsasakamagbalikpagbabayadkagatollumindoltagpiangsementongtotoonapansinapelyidosignalmaghilamospinalalayaspakakasalantumawaallergynatutulognaglabapanginoonnakapikitkaraokecommercialpaglingonmatagumpayinstrumentalvaliosaanongbobotoricotenganahulogbagamatsinelasdespuesgardennoongmisteryodadaloindividualstusindvissurroundingseneropinatirailagaysapilitangsalbahemagalingmerrycomputere,sinimulanbigotecalcium1950sdikyamlenguajehappenedmartesakin1980busyangconnectingsumabogfuenatanggapabalataingacarekablanlabasoutposteasiermisusedrestawanpakpaktingdilimmemorialadvertisingventaresultlayuninhimselfcomputerestudenttrackpresstabidoingaffectconsidermonitorimpactedalignscommercereleasedrelievedkittangonakikini-kinitaeksammakapangyarihankinakabahanmaghandasumusulatnakangisingtipkumanangovernorsutilizanumiinitnanoodsayaofficenamconworkdayamerican