Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "continues"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's legacy continues to inspire and influence scientific research today.

4. Einstein's legacy continues to inspire scientists and thinkers around the world.

5. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

6. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

7. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

8. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

9. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

10. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

11. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

12. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

13. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

14. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

15. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

16. Today, Bruce Lee's legacy continues to be felt around the world

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Oh gosh, you're such an ambisyosang frog!

2. Using the special pronoun Kita

3. The patient was discharged from the hospital after recovering from pneumonia.

4. They have won the championship three times.

5. Nakatayo ang lalaking nakapayong.

6. Mainit sa Pilipinas sa buwan ng Abril.

7. Ang tagpo ng nag-iisang bata sa lansangan ay nagdulot ng hinagpis sa aking damdamin.

8. Wala na naman kami internet!

9. Busy yung dalawa. Si Aya nandito. sagot ni Lana.

10. In conclusion, the telephone is one of the most important inventions in human history

11. They do yoga in the park.

12. Hawak ang tirador ay sinaliksik ni Kiko ang buong paligid.

13. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

14. The hospital had a special isolation ward for patients with pneumonia.

15. Siya ang may pinakamataas na grado sa klase, samakatuwid, siya ang napiling valedictorian.

16. Karaniwang mainit sa Pilipinas.

17. Satu titik hitam bisa merusak noda yang putih.

18. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

19. Sino ang kasamang kumanta ni Katie?

20. Salamat po at pinagbigyan nyo ako.

21. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

22. The company's acquisition of new assets will help it expand its global presence.

23. Ang pagpapalitan ng mga bulaklak ay karaniwang ginagawa sa kasal.

24. Pakipuntahan mo si Maria sa kusina.

25. Mahal na mahal kita.. wag mo muna akong iwanan, please.

26. Mga prutas ang tinitinda ng tindera.

27. Siya ho at wala nang iba.

28. I am enjoying the beautiful weather.

29. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

30. Sa komunikasyon, mahalaga ang wastong pag-unawa at pagtukoy sa mga hudyat upang magtagumpay ang pagpapahayag ng mensahe.

31. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

32. La esperanza y los sueños son las llaves para la felicidad y la realización personal. (Hope and dreams are the keys to happiness and personal fulfillment.)

33. Les employeurs offrent des formations pour améliorer les compétences des travailleurs.

34. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

35. Kailangan ko ng bumalik sa aming kaharian dahil kung hindi ay hindi na tayo muling magkikita pa.

36. Ayon sa albularyo, may nakabati raw sa sanggol kaya siya nagkasakit.

37. At hindi papayag ang pusong ito.

38. Nakapagtataka na may ilang tao na hindi pa nakatikim ng pulotgata.

39. Palibhasa ay karaniwan nang nakakamit ang kanyang mga layunin dahil sa kanyang determinasyon at tiyaga.

40. Masarap at manamis-namis ang prutas.

41. Pinamunuan niya ang mga Pilipino laban sa mga Espanyol at kalaunan sa mga Amerikano.

42. Sa harapan niya piniling magdaan.

43. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

44. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

45. By refusing to compromise, she ended up burning bridges with her business partner.

46. Let the cat out of the bag

47. The Twitter Explore tab provides a curated feed of trending topics, moments, and recommended accounts.

48. Omelettes are a popular choice for those following a low-carb or high-protein diet.

49. Kapag walang magtutulungan, walang magtatagumpay.

50. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

Recent Searches

bigotecontinuescreationinalispag-akyatcarmencarsguiltypagodbookpangalankesohanmalinisbingbingpresyohangganghanap-buhayelectionspinagpatuloycantidadginisinglenguajecondoilantravelvigtigstesaturdaynaghihirapeffectpalayonilalangnapaiyakmaskinerpagkakatayosinabimuyngunitnakatulogalamkoreanumalispropesorlastzebranakuhangnakikilalangnakalipastinymatayogofrecenginamalimitmaibigayespigasdeterminasyonincidencepinaulanangoalpagkabiglagabrielthingsmapaibabawdecreasednamanghaaudio-visuallymayroonulanarabiasinumanmagsasakamesangkonsultasyonpinakidalabinawituminginlipatmakipagtagisantaun-taonmarketplacesmalapitdeltelevisedwhybeentumatawadparusahanbasahanvegasbahalanagliliwanagnalalaglagpagkasabinanamanblueplasaleeparikabutihanmimosapanahonimpactkumatokbusyvalleydiintinuturotaksibutterflymaisusuottatlonakauwibeybladepakainintelecomunicacionesfollowingpinapasayaoktubreculturekonsentrasyonpisngivaccinespakibigaypinagbigyangatasmagagawadropshipping,harapanpwestopasyabaclaranhousetrencomputereroonnami-misskarangalanafterkinumutancultivatedbanlagmissionkainanbibilinakakalayonagsunuranexigenteuulamintingbulongpioneerbumagsaktuluyanparkingnag-uwimagtatakagumagamitiintayinmasungitkidkiranhoysoonpulispinakamalapityangnanaytuyongtsakaniyangcoachingnaroonsumisidiniangatkaugnayanvivabisiginspirationstoreiniinombalotnyeshowgigisingtandangnagtatakbobiglaanibilinapagodbosesvampiresnucleartonightpinapakingganlagnat1954nahuloglalabasulamgantinghumanap