Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "continues"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

3. Einstein's legacy continues to inspire and influence scientific research today.

4. Einstein's legacy continues to inspire scientists and thinkers around the world.

5. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

6. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

7. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

8. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

9. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

10. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

11. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

12. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

13. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

14. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

15. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

16. Today, Bruce Lee's legacy continues to be felt around the world

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Palibhasa ay may kakaibang pagtingin sa mga bagay dahil sa kanyang malawak na kaalaman at pag-unawa.

2. Inilista ni Michael ang lahat ng maiingay sa klase.

3. Saan naman? nagtatakang tanong ko.

4. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

5. Nakakapagod pala umakyat ng bundok.

6. Pahiram ng iyong sasakyan, wala akong ibang masasakyan pauwi.

7. Hindi mo malalaman na maarte siya sa kanyang kagamitan dahil lagi itong malinis at maayos.

8. Naghingi ako ng pabor at hiramin ang sasakyan ng aking kapatid para sa isang espesyal na okasyon.

9. How I wonder what you are.

10. Ang suporta ng pamilya ni Carlos Yulo ang naging pundasyon ng kanyang tagumpay.

11. Musk is known for his ambitious goals and his willingness to take on seemingly impossible challenges.

12. Nandoon lamang pala si Maria sa library.

13. Ay shet. Ano ba yun natanong ko. Biglaan.

14. Ang pagkakaroon ng malalapit na kaibigan ay isang nakagagamot na karanasan.

15. Nagtatrabaho ako sa Youth Center.

16. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

17. Ibinigay ni Ana ang susi kay Sally.

18. Limitations can be a result of fear or lack of confidence.

19. Patuloy ang labanan buong araw.

20. Los alergenos comunes, como el polen y el polvo, pueden causar tos en personas sensibles a ellos.

21. Sinubukan kong gumawa ng kakanin gamit ang pulotgata, ngunit hindi ko nagustuhan ang lasa.

22. Para lang ihanda yung sarili ko.

23. Sa kaibuturan ng kanyang damdamin, mahal niya ang kanyang mga kaibigan.

24. Retweeting is a feature that allows users to share others' tweets with their own followers.

25. Når man bliver kvinde, kan man opleve en øget frihed og selvstændighed.

26. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

27. Wala akong maisip, ikaw na magisip ng topic!

28. Naramdaman ko ang pagdidilim ng aking paningin nang biglang nagpakalma ang mundo sa aking paligid.

29. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

30. Endvidere er Danmark også kendt for sin høje grad af offentlig velfærd

31. Siya ay nanalangin para sa kaluluwa ng kanyang yumaong kaibigan upang ito'y makalaya na mula sa purgatoryo.

32. Mag-uusap kami sa makalawa ng tanghali.

33. Los bebés pueden nacer en cualquier momento del día o de la noche, y algunas veces pueden llegar antes o después de la fecha prevista.

34. Naglalaro ang walong bata sa kalye.

35. Napakaganda ng bansang Pilipinas.

36. Television has a rich history, and its impact on society is far-reaching and complex

37. Dadalaw ako kay Lola Sela bukas.

38. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

39. Les employeurs peuvent promouvoir la diversité et l'inclusion sur le lieu de travail pour créer un environnement de travail équitable pour tous.

40. Ilang beses ka nang sumakay ng eroplano?

41. Masarap higupin ang sinigang na may maraming gulay.

42. Einstein's ideas challenged long-held assumptions about the nature of space and time.

43. Sa kabila nito, nanatili siyang aktibo sa politika ng Pilipinas pagkatapos ng pananakop.

44. Dumalaw si Ana noong isang buwan.

45. Hindi ko na kayang itago ito - sana pwede ba kita ligawan?

46. Nakipagtagisan sya ng talino sa kapwa estudyante.

47. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

48. The hotel room had an absolutely stunning view of the city skyline.

49. Narito ang pagkain mo.

50. Les travailleurs peuvent participer à des programmes de mentorat pour améliorer leurs compétences.

Recent Searches

harmfulcapitalistsincepromotingfacekilocontinuesencounterilanbinulabogupworkisinamasiyamakonakakatakotnagtungomeetingjamessumalarichoutpostmamibipolardurigandajaneagajerrygranexamplekapilingaffectmessageeffectpointdraft,regularmentedingdingsakupinventamuchmaputigubatbiyasgriponaka-smirknapakatalinokinapanayamnaglinisexpensespisngitindabinatinagtatanongleksiyonvegaspalmasakayhalikanpaghahabimakukulaymurakumulogborgerepaidparangpangangailangannicopawiininiisipmakapagempakelumiwagothermatagumpayhistoriacreatedelejagiyapresleykuwartonagtatrabahoinaantayebidensyaopdelttaonpakibigayperseverance,partymagturodugomananaigkatotohananpanindangbalangdioxidegumuhitmakasarilingletterreboundtagalikawiniwandividesdragonsamufuncionarmuchajigsawtoritadongfatqualitynasirapaosboardbatispecializedlimahanbotantetsenagbabasatiyanilawnakaakmakalaunanbroadmalawaksinikapdogkomunikasyonjoybangkamangingisdangelitetamarawlalabascandidatepamagatniligawanhinukaypagkaawahintuturoiginitgitnakapuntacapablekinasquatternamangngiyoorasandiwatapagsahodmamalastimedrawingthroughoutbwahahahahahapaghingiannikanagawangnagpasalamatnapakamisteryosonagkakasayahannasasakupanmerchandisekaninumannamulatinfluencesmanilbihannanigasparolcornernalalabitabinapadaanalas-tresginooiniuwimunasoreseesinodisenyowaldomamarilitutollulusogkinabukasannagbanggaanpagka-maktolnageenglishtaga-nayonmanamis-namiskalakihannakakadalawdentistamagsunoginteractnagkapilatnakasahod