Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "election"

1. Congress are elected every two years in a process known as a midterm election

2. The President is elected every four years through a process known as the presidential election

3. Uncertainty about the outcome of the election has caused tension in the community.

Random Sentences

1. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

2. Baka naman nag message na sayo, hinde mo lang alam..

3. Paki-charge sa credit card ko.

4. In the years following his death, Presley's legacy has continued to grow

5. Kebahagiaan adalah perjalanan pribadi yang unik bagi setiap individu, dan penting untuk menghormati dan mencari kebahagiaan yang paling sesuai dengan diri sendiri.

6. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

7. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

8. Hindi pa rin matukoy ng mga pulis kung sino ang salarin sa pamamaril sa opisina.

9. Gaano katagal ho kung maglalakad ako?

10. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

11. Bumilis bigla yung tibok ng puso ko.

12. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

13. Bumili ako ng sarong. Ikaw, saan ka nagpunta?

14. Dumaan ka kay Taba mamayang pag-uwi mo, narinig niyang bilin ng ina.

15. Napansin ni Mang Kandoy na ang dugo ng diwata ay puti.

16. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

17. Pnilit niyang supilin ang hangaring makasilong.

18. Ang mga bulaklak sa mesa ay nagbigay ng mabangong ambiance sa hapag-kainan.

19. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

20. Ikinagagalak kong makita ang pag-unlad mo sa buhay.

21. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

22. Keep studying and hang in there - you'll pass that test.

23. Mahirap ang walang hanapbuhay.

24. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

25. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

26. Sa ganang iyo, sapat na ba ang ginawa niya upang maitama ang kanyang pagkakamali?

27. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

28. Beast... sabi ko sa paos na boses.

29. La creatividad puede ayudar a solucionar problemas de manera más efectiva.

30. Mahalagang magtiwala sa ating kakayahan upang maabot natin ang ating mga pangarap, samakatuwid.

31. Kinabukasan ay nag paalam ulit si Ana na aalis pagtungo sa kagubatan, dahil tinawag daw siya ulit ng nagbigay ng pagkain sa kaniya.

32. Ang bayanihan ay nagpapalakas ng samahan at pagkakaisa sa aming pamayanan.

33. Las hierbas medicinales se utilizan desde hace siglos para tratar diversas dolencias.

34. Hindi naman. Baka lang pagod ka na...

35. Lumapit sakin si Kenji tapos naka smile siya.

36. Doble kara ang tawag sa mga balimbing na tao

37. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

38. Gusto mo ba ng mainit o malamig na kape?

39. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

40. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

41. Sa gitna ng laban, nagbabaga ang determinasyon ng boksingero na manalo.

42. Ipanghampas mo ng langaw ang papel.

43. Larry Bird was a versatile forward and one of the best shooters in NBA history.

44. Work is a necessary part of life for many people.

45. Mabuti na lamang at nandyan ang kanyang kaibigan.

46. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

47. Bigla siyang bumaligtad.

48. Magaganda ang resort sa pansol.

49. Nagsasagot ako ng asignatura gamit ang brainly.

50. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

Similar Words

elections

Recent Searches

executiverespektiveelectioncigaretteslakasprinsesangworkdaymakalipasnanahimikmemoriaanothermaingatmagsisinenaglakadenergiresponsibledisensyomini-helicopter4thpahiramdangerousnogensindethingresignationrolledkainwithoutbinanggakuwebaestablisimyentosaferforskelsomehvorcomunesmakapasokdrinksrightmatutulogrecibirnerosdiagnosticwealthpaslitdinaluhanthereforemag-amanaglalambingarmedtheseydelsernapansindivideddisposaldagligeginoongbonifaciomediumbaryoumagasincembricosoverallburoltwocertainhubadamaunderholderlalargakahusayanpagsasalitacivilizationxviifuekasinggandaminamahaleveryothernunodinukotpatingsecarsemuligtskypassivethroughoutgrahamdamingbinabalikpaki-chargeislaevolucionadoeachsirnaglabadalacknegativestagetiketdinalawandamingfuturesomethingmag-inauntimelyasthmaredigeringitemsactivitypanginoonlucyhundredmulighedbroadcastingincreasesreplacedreadsumarapdilapumapaligidseniorshareinilingglobaltangoeffectsflyvemaskinermaskineraccessmayroongginamotdeletingpag-aapuhapmakausapmandukotmulighedermananalosandwichnagpanggappacebitiwansystems-diesel-rungantingcespaulabarrocoallergyallowingpaladsetstevegraduallyibabawsectionsintelligenceartificialipapaputolscaleleveragepracticadosearchfriendcurtainsstyrersystemposts,easiernagbasaaplicacionestoolsigurokamandagexportroboticresourcesglobepagbahingbasedasofaultproperlypagemathtypesinventedfremtidigedumiretsometodevotesautomatisereandroidlearnfatalo-ordermetroterminoginoocomputerewhile