Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "own"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He makes his own coffee in the morning.

6. He used credit from the bank to start his own business.

7. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

8. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

9. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

10. In this industry, singers who can't write their own songs are a dime a dozen.

11. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

12. Many cultures have their own unique traditions and customs surrounding weddings.

13. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

14. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

15. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

16. Retweeting is a feature that allows users to share others' tweets with their own followers.

17. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

18. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

19. The bag of groceries was too hefty for the elderly woman to carry on her own.

20. The fashion designer showcased a series of collections, each with its own unique theme and style.

21. The news might be biased, so take it with a grain of salt and do your own research.

22. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

25. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

26. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

27. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

28. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

29. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

2. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

3. Wala siyang ginagawa kundi ang maglinis ng kanyang bakuran at diligin ang kanyang mga pananim.

4. Sa facebook ay madami akong kaibigan.

5. Aanhin ko 'to?! naiiritang tanong ko.

6. El puntillismo es una técnica de pintura que utiliza pequeños puntos de color para crear la imagen final.

7. Ngumiti siya ng malapad sabay hagikgik.

8. Pagkalipas ng dalawang linggo ay nakatanggap si Nicolas ng sulat galing kay Haring Bernardo.

9. The concert raised funds for charitable causes, including education and healthcare.

10. Ang mga magsasaka sa kanayunan ay nag-aapuhap ng suporta mula sa gobyerno para sa kanilang mga pananim.

11. Kailangan natin ng mga kubyertos para makakain ng maayos.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. También es conocido por la creación de la Capilla Sixtina en el Vaticano.

14. Mathematics can be used to model real-world situations and make predictions.

15. Hindi dapat natin balewalain ang mga taong nasa paligid natin, datapapwat ay may mga pagkakataon na hindi natin sila napapansin.

16. Hindi nakagalaw si Matesa.

17. Napatingin ako sa kanya, Bakit naman?

18. May meeting ako sa opisina kahapon.

19. L'entourage et le soutien des proches peuvent également être une source de motivation.

20. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

21. Narinig kong sinabi nung dad niya.

22. Sa mga nakalipas na taon, yumabong ang mga blog na mayroong malaking audience.

23. She has completed her PhD.

24. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

25. Ano ang mga apelyido ng mga lola mo?

26. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

27. Nakita rin kita! ang sabi niyang humihingal

28. Hindi maikakaila, mas malakas ang pamilyang magkakasama.

29. The patient was discharged from the hospital after recovering from pneumonia.

30. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

31. Tinignan ko siya sa nagtatanong na mata.

32. Nagkakaisa ang aming angkan sa pagpapahalaga sa edukasyon.

33. Natawa ako sa maraming eksena ng dula.

34. Sana ay makapasa ako sa board exam.

35. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

36. Tuwing mayo kung ganapin ang eleksyon.

37. The dog barks at the mailman.

38. Malaya syang nakakagala kahit saan.

39. I have a Beautiful British knight in shining skirt.

40. Owning a pet can provide companionship and improve mental health.

41. Ang pagsalungat sa agaw-buhay na sistema ng lipunan ay kailangan upang magkaroon ng tunay na pagbabago.

42. Ang sugal ay naglalabas ng mga salarin na nagpapayaman sa pamamagitan ng pag-aabuso sa mga manlalaro.

43. The football field is divided into two halves, with each team playing offense and defense alternately.

44. Puwedeng gamitin ang pagguhit upang magpahayag ng mga saloobin at mensahe sa mga taong mahal mo.

45. Nagpapadalhan na kami ng mga mensahe araw-araw dahil nililigawan ko siya.

46. Pagkat kulang ang dala kong pera.

47. Kung saan ka naroroon, doon ka maglingkod.

48. At leve i overensstemmelse med vores personlige overbevisninger og værdier kan styrke vores samvittighed.

49. Di nagtagal, muli niyang naramdaman na tila nangangalirang na naman ang kanyang balat.

50. Ang pagpili ng mga kasuotan para sa kasal ay dapat ayon sa tema ng kasal.

Similar Words

gowndownlockdownknown

Recent Searches

ownhayopsteamshipslasknowkanilabuwisbagoharmfulsumpanyapapayagjagiyamalambotginawaranwasakguidanceinteractgenepaligidmapadalidalawatinapayubodclubhomestelevisedtayotabingtradicionalaralkelangansarongtinderatwo-partymakaraantipiyongalitlilimmalayaumiinomtumulongpanunuksogubathaskatandaantinulungannag-usapnakayukonabuopaanongherundermatapangsipagmalapitanpatpatsandalinagawabalik-tanawnavigationlagaslasnaglalabapayonag-aalangankatapatsubalitpagbebentamatangkadipinikitmakikinigtangekssolidifyisdananaytalaganakangitigiyeramahiwagahiningaakomag-ingatcosechastungkoltumahantaglagashetobosespawisoursupilinworkpeoplenanlalamigsuotdelnatatanawmahusayhelpmagkabilangsamakatuwidbatatelangtanawininilagaypaanonuclearmuchakailanmanrisekongipagbilikalayaanmagsi-skiingmarahiltarangkahan,siglatuladpaghihirappansincreationsirmananakawfederalismmindsantoutak-biyamahagwayseniorbukodhanggangbaliwmatanewskaninangpanitikan,pabalangpag-asatiyakahasinhalegivelandetsundaenalulungkotkartonhvoringaypumuslitwidelykinabibilanganpanitikannagtataasnagsasanggangpahingalparecarsdvdmagsasakasiemprewalangmaynilananiniwalagayunmanmangangalakaltelebisyonnanditotag-ulanpamahalaankarapatanpotentialmapangasawadadiba-ibangbalikatcloseeksperimenteringinstrumentalinuulcerbilerinternalmaisraisetulisaniskedyulitinindigmbalomamahalinganyantabing-dagatmagulangbingbingspentmangdalawinmabangobyemakapangyarihangnoongtarcila