Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "own"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He makes his own coffee in the morning.

6. He used credit from the bank to start his own business.

7. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

8. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

9. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

10. In this industry, singers who can't write their own songs are a dime a dozen.

11. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

12. Many cultures have their own unique traditions and customs surrounding weddings.

13. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

14. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

15. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

16. Retweeting is a feature that allows users to share others' tweets with their own followers.

17. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

18. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

19. The bag of groceries was too hefty for the elderly woman to carry on her own.

20. The fashion designer showcased a series of collections, each with its own unique theme and style.

21. The news might be biased, so take it with a grain of salt and do your own research.

22. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

25. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

26. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

27. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

28. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

29. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. A lot of laughter and joy filled the room during the family reunion.

2.

3. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

4. Binigyang diin niya ang pagpapasakit ng Anak ng Diyos.

5. Estudyante sina Rita at Fe sa UP.

6. The foundation's charitable efforts have improved the lives of many underprivileged children.

7. Eine hohe Inflation kann die Kaufkraft des Geldes drastisch reduzieren.

8. Kapag mayroon kang kaulayaw, hindi ka mag-iisa sa mga pagsubok na iyong kinakaharap.

9. Siya nama'y maglalabing-anim na.

10. Hindi kita puwedeng iwan dahil mahal kita.

11. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

12. Når man bliver kvinde, er det vigtigt at have en sund livsstil og pleje sit helbred.

13. Upang magawa ito, pinag-aralan niyang makapagsalita ng kanilang wika.

14. La pintura al óleo es una técnica clásica que utiliza pigmentos mezclados con aceite.

15. Pupunta si Mario sa tabing-dagat sa hapon.

16. Maraming bayani ang naging simbolo ng pag-asa at inspirasyon sa panahon ng krisis at kahirapan ng bayan.

17. Les scientifiques travaillent ensemble pour résoudre des problèmes complexes.

18. You can't judge a book by its cover.

19.

20. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

21. Hindi ako makapaniwala sa nakikita ko.

22.

23. ¿Puede hablar más despacio por favor?

24. Galing sa brainly ang isinagot ko sa asignatura.

25. Sinubukan kong magpakilig sa aking nililigawan sa pamamagitan ng pagkanta ng isang love song.

26. We need to get this done quickly, but not by cutting corners.

27. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

28. Mahilig sa paglilinis si Susan kaya't hindi siya nag-aalala kapag kailangan niyang maglaba ng malalaking bagay.

29. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

30. Les employeurs recherchent des travailleurs fiables et ponctuels.

31. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

32. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

33. Madalas akong nakakarinig ng kakaibang ingay sa labas ng bahay sa hatinggabi.

34. Gusto kong magbasa ng libro, datapwat hindi ko alam kung anong libro ang pipiliin ko.

35. Nagbigay ako ng tulong sa mga nangangailangan kaya masayang-masaya ako ngayon.

36. Kailangan mong matuto ng pagsusuri upang mas maintindihan ang kaibuturan ng isang sitwasyon.

37. The new restaurant in town is absolutely worth trying.

38. Ilang tao ang nahulugan ng bato?

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. My mom always bakes me a cake for my birthday.

41. Ang laki ng gagamba.

42. Ano ang malapit sa eskuwelahan?

43. Det har ændret måden, vi interagerer med hinanden og øget vores evne til at dele og få adgang til information

44. Leonardo da Vinci también pintó La Última Cena.

45. Dumaan ako sa silid-aralan upang magpasa ng papel sa guro.

46. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

47. Pagapang na bumaba ng hagdanan ang anak, sa pagsayad ng mga kamay nito sa lupa ay unti-unti itong nagbago.

48. Ano ka ba. Mas mahalaga ka naman sa dota noh.

49. Pinaoperahan namin siya, naging matangumpay naman ang operasyon, ngunit hindi na ito kinaya ng kanyang katawan.

50.

Similar Words

gowndownlockdownknown

Recent Searches

ownbrindarfuelproblemamurangoverallpshangabstainingeasierwelladdressstudenttabasspaeksaytedthroughoutpassworddonefiverrlayout,dependingipinalitdumaramiadaptabilitystringputingliv,magpagalingnagtataasdekorasyonturismomagbabagsikbagoskills,anyonahawakandisenyongpagpapautangsalecharmingpinakamaartengenfermedades,sponsorships,artistasikinalulungkotnaka-smirkpinagalitanreserbasyonpaki-translatenagulathealthierencounterpagkakayakapnapaplastikanmedya-agwakaharianpinuntahankabundukannakikiakapamilyalumikhapaghihingalopresleynatinkomedornapagtantototoongenglandkidkirannakasakitbasedkissnalalabingkinasisindakanscientificpangungusaphandaantinangkangmalapalasyopaki-chargesagasaankahoypaninigasnatabunantinataluntongiyeranakakaanimnakatuonhanapbuhaytaglagasvideosnagagamitlumilipadmarioika-50patawarinpakiramdammagselos1970spagbabantabasketbollagnatmabagalnaliligonakaakyatiniuwikampeonhinugotisinarakababalaghangnakapikithinatidsunud-sunodmakausappagiisipmakisuyobighanitindahanbilihinsakalingrememberedrevolutioneretlabistayorepublicankapalkumustatilifederalperseverance,diliginnangingilidmahigpitlaganapmatangkaddealkalalakihaneyasandalihoteltsuperhagdanmatesao-ordertsinelasmanilasikipsellingmaisipasianapapatingintalentdibalenguajeconsumefriendstokyobalatchickenpoxmeronkulotpublicationkatagalankasalananmrslaryngitisinulitarguegraphicmakasarilingmukaadopteditutolparangnagnaggalazooclientspanahontuwanglingidprinceduonpeacemamulotreplacedbarrocolapitanpagodhehediagnosticitimgabeso-calledbugtongpakpakkalakihanmajorjosh