Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "own"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He makes his own coffee in the morning.

6. He used credit from the bank to start his own business.

7. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

8. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

9. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

10. In this industry, singers who can't write their own songs are a dime a dozen.

11. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

12. Many cultures have their own unique traditions and customs surrounding weddings.

13. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

14. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

15. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

16. Retweeting is a feature that allows users to share others' tweets with their own followers.

17. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

18. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

19. The bag of groceries was too hefty for the elderly woman to carry on her own.

20. The fashion designer showcased a series of collections, each with its own unique theme and style.

21. The news might be biased, so take it with a grain of salt and do your own research.

22. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

25. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

26. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

27. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

28. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

29. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. Membangun hubungan yang mendalam dengan diri sendiri dan orang lain, serta merayakan momen-momen kecil, memberikan kebahagiaan yang tahan lama.

2. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

3. Sa aking paglalakad, natatanaw ko ang magandang tanawin ng bukid na pambihirang nagpapalaya sa aking isipan.

4. Kahit paano'y may alaala pa rin siya sa atin.

5. Elije el lugar adecuado para plantar tu maíz

6. Ang tubig-ulan ay maaaring magdulot ng malinis na hangin sa pamamagitan ng pag-alis ng polusyon sa hangin.

7. Kahit na lilipad ang isip ko'y torete sa'yo.

8. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

9. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

10. Sa tingin ko ay hindi ito magiging epektibo kaya ako ay tumututol sa kanilang desisyon.

11. Maganda ang bansang Singapore.

12. Ano ang kulay ng notebook mo?

13. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

14. Sa takot ng mga tao sa pagsalakay ng mga tulisan, ibinaon nila ang gong sa isang lugar na malapit sa gubat.

15. Sumama ka sa akin!

16. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

17. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

18. A quien madruga, Dios le ayuda. - The early bird catches the worm.

19. The company suffered from the actions of a culprit who leaked confidential information.

20. Omelettes are a popular choice for those following a low-carb or high-protein diet.

21. Nakikita mo ba si Athena ngayon?

22. Higupin natin ang gatas habang mainit pa.

23. Nagitla ako nang biglang may lumabas na ahas mula sa mga halamanan.

24. Ang kuripot ng kanyang nanay.

25. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

26. Pumuslit ang luha sa sulok ng kanyang mga mata.

27. Es importante no cosechar demasiado temprano, ya que las frutas aún pueden no estar maduras.

28. Mayamaya ay parang kidlat na gumuhit sa kanyang alaala ang gusgusing batang kanyang nakabangga.

29. Magkano ang bili mo sa saging?

30. Dalawa ang pambura sa silid-aralan.

31. Kailangan nating ipakita ang bukas palad na pagtanggap sa mga taong mayroong maling ginawa upang matututo sila.

32. They have been creating art together for hours.

33. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

34. Kumikinig ang kanyang katawan.

35. La science est la clé de nombreuses découvertes et avancées technologiques.

36. Mula sa mga puno, naglipana ang mga bunga na naglalagay ng kulay sa kapaligiran.

37. Sumuway sya sa ilang alituntunin ng paaralan.

38. Holy Week er en tid til eftertanke og refleksion over livets cyklus og død og genfødsel.

39. Hindi matatawaran ang hinagpis ng mga magulang na nawalan ng kanilang anak sa digmaan.

40. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

41. Electric cars are quieter than gasoline-powered cars due to the absence of an internal combustion engine.

42. Selvstændige medarbejdere arbejder ofte på egen hånd.

43. Kailangan kong magtiwala sa aking sarili upang maalis ang aking mga agam-agam.

44. Nosotros decoramos el árbol de Navidad juntos como familia durante las vacaciones.

45. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

46. Naka color green ako na damit tapos naka shades.

47. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

48. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

49. Bilang paglilinaw, wala akong sinabing tataasan ang singil, kundi magkakaroon lang ng kaunting pagbabago sa presyo.

50. Lending money to someone without collateral is a risky endeavor.

Similar Words

gowndownlockdownknown

Recent Searches

owntinawananhacerwondernag-away-awayguroadditionally,pulgadanganagkabungayakapsuwailnapakabiliscouldtiyaklagnatsaansompagkamanghadagatpangingimisiyudaddisenyosumangestablisimyentoharapcompartennag-emailkasaldavaoginawasalbahesumigawpingganpackaginggalingsang-ayonwalisscientistgiftbusogmalungkotganyannagwikangbigbibilhinsiguradopamumuhaysannecesitabilinnahintakutanhonbumababakulunganikawalambabaearaw-arawsitawkapwatotoongpag-asahospitalbehalfmakikinigipinaalamlagaslasniyonplayedpumikitstudentsnawalangisugasnobfindealilaintawagipapamanaeuphoricdalawinbumilistilimusickulangsumasaliwisa-isamartafuncionesyeheymasipagdaigdigzoomdisposalcuandopookpaslitsurengayokalagayanpagtitindatenermagkasing-edadtumugtogumangatsapatosgalaksufferdamittvsexpertisekitanandiyantilpinauwimetodiskhimutokhinihilinglakadnagpepekeilingbienhigaanbabasahinmakuhakomunidadumilingrevisebulalolausednaisultimatelymathnapaluhabecomeskutsaritangmagalanghubad-barobilerreadingkingtodowereinformedroboticswakastangannag-aagawanhaponkeeppagsambaibabanatininterestshumanninabroadarbejdernatatawateleviewinghudyatiniuwiskillsnagreklamotinikgraduationtiketsasagotpawiskailanmancover,halagabanalenergy-coalmagtataposubos-lakastwo-partyumayositinagoumiilingpasensiyavariousnagngingit-ngitdebatesdalagagawinrememberedkutogeneratedgumagawaisinalanghunyoflyvemaskinertotoobinatanapapasabaylumakasnoblebumaha