Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "own"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He makes his own coffee in the morning.

6. He used credit from the bank to start his own business.

7. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

8. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

9. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

10. In this industry, singers who can't write their own songs are a dime a dozen.

11. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

12. Many cultures have their own unique traditions and customs surrounding weddings.

13. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

14. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

15. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

16. Retweeting is a feature that allows users to share others' tweets with their own followers.

17. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

18. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

19. The bag of groceries was too hefty for the elderly woman to carry on her own.

20. The fashion designer showcased a series of collections, each with its own unique theme and style.

21. The news might be biased, so take it with a grain of salt and do your own research.

22. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

25. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

26. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

27. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

28. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

29. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. Sa loob ng zoo, pinagmamasdan niya ang mga hayop na naglalaro sa kanilang kulungan.

2. La pobreza extrema puede llevar a la inseguridad alimentaria y la desnutrición.

3. Para poder cosechar la uva a tiempo, debemos empezar con la vendimia en septiembre.

4. Madalas syang sumali sa poster making contest.

5. Naglakbay siya sa ibang bansa upang hanapin ang hinugot niyang inspirasyon.

6. Nagpipiknik ang pamilya namin kung maaraw.

7. Ano ang ikinatatakot ng mga tao sa bagyo?

8. Nag merienda kana ba?

9. He was known for his active and controversial presence on social media, particularly Twitter.

10. Nandiyan po ba si Ginang de la Cruz?

11. Ang kalayaan ay isa sa mga pinakamahalagang karapatan ng bawat tao.

12. Hindi kita puwedeng iwan dahil mahal kita.

13. Madalas sya nagbibigay ng pagkain sa pulubi.

14. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

15. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

16. Nang makita ang paparating na ulan, kumaripas ng uwi ang mga bata mula sa palaruan.

17. Kung saan ka naroroon, doon ka maglingkod.

18. Kailangang mabagal at marahan ang apoy.

19. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

20. Nag-aalala ako dahil biglaan siyang umalis nang walang abiso.

21. Nagpasya ang salarin na sumuko sa pulisya matapos ang mahabang panlilinlang.

22. Da Vinci murió en Francia en el año 1519.

23. La acuarela es una técnica de pintura que utiliza pigmentos mezclados con agua.

24. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

25. Ang pakikinig sa mga paborito kong kanta ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

26. Nasa sala ang telebisyon namin.

27. Sa gitna ng pagdidilim, napansin ko ang nagliliwanag na ilaw mula sa aking bahay.

28. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

29. Los recién nacidos son pequeños y frágiles, pero llenan nuestros corazones de amor.

30. Saan pupunta si Trina sa Oktubre?

31. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

32. Eksport af grøn energi er en vigtig del af den danske eksportstrategi.

33. makaraan ang ilang sandali, dahan-dahan at nanlalambot siyang tumindig, nakatuon ang mga mata kay Ogor.

34. Sa ganang iyo, sapat na ba ang ginawa niya upang maitama ang kanyang pagkakamali?

35. Me gusta comprar chocolates en forma de corazón para mi novio en el Día de San Valentín.

36. Magandang-maganda ang pelikula.

37. Nasa harap ako ng istasyon ng tren.

38. Pagkain ko katapat ng pera mo.

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. Gusto kong matutong tumugtog ng gitara.

41. Biglang naalaala ni Aling Rosa ang huli niyang sinabi kay Pina, na sana'y magkaroon ito ng maraming mata para makita ang kanyang hinahanap.

42. We were trying to keep our engagement a secret, but someone let the cat out of the bag on social media.

43. Saan siya nagtapos ng kolehiyo?

44. Ang lahat ng taong napapadaan sa nasabing puno'y napapahinto dahil sa dami ng bungang nakasabit sa mga sanga.

45. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

46. Las hojas de los cactus son muy resistentes y difíciles de cortar.

47. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

48. Ang tagtuyot ay nagdulot ng malawakang pagkamatay ng mga alagang hayop.

49. Ang mga marahas na laban sa karapatang pantao ay dapat labanan at iwaksi.

50. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

Similar Words

gowndownlockdownknown

Recent Searches

nagdaramdamown1000excuseorugahulingchangenarinigsumalilinebiyahejackyjustsorryhumanojerrybinabalikmarchbumababasingeripapainitbubongsarilingsincelaterballshockactingconventionalcommunicationsmakapasokinteractsequebetweenkiteditbringingtelevisedalinlcdincreasedipagtimplaemocionespangambaeverythingpuedemaglalaroproductividadbiyayangtumalimmaasahanoperativoslarangandiaperfe-facebookplagasfauximagesmatapospinsanfinishedvotesnagsasabingscalecomplexcrucialpanginoonubuhinpresidentenanlalambotsocialepakpaknagkakatipun-tiponnagmamaktoleconomytrabahonakabibingingnatatawawhichleadfirstmaranasansocialestuwang-tuwangayongampliaplaysinantokbookdealpersonalnaiinitanworkdaycolorreguleringmind:feedbacknagpakitamagsasalitapodcasts,systemcualquierpeksmantinahakmagpapigillondonsiksikanpumilihumalodispositivore-reviewlumibotpasyentesasagutinbefolkningen,manggagalingtreatstagtuyotvideos,alas-diyeshundredespecializadasnailigtastutungonapasigawnakakatabaambisyosangbagsakbeautysundalohimihiyawkapasyahanpagtawainaabotnagmumuntingmakulitsamantalangpatawarininlovepapayapakiramdamcompaniesnasaangcombatirlas,gawaingkristokulturlahatmaya-mayaparaangmakalinggiraysunud-sunodininompagongmakisuyonakabaonconvey,sakenkirbyminahanhelenaunospauwigatolmanalopagsidlanmensarturopinisilibabawdumilatmatagumpaysagutinfederalmamarilnapapatinginexpeditedmulinayonsayamadalingtomorrowlinamatangumpaynovembercompletamentetrinaganitobagalbinibilibuhoknararapatpatienceangeladiseasessumimangotgrowthkendi