Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "own"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He makes his own coffee in the morning.

6. He used credit from the bank to start his own business.

7. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

8. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

9. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

10. In this industry, singers who can't write their own songs are a dime a dozen.

11. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

12. Many cultures have their own unique traditions and customs surrounding weddings.

13. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

14. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

15. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

16. Retweeting is a feature that allows users to share others' tweets with their own followers.

17. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

18. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

19. The bag of groceries was too hefty for the elderly woman to carry on her own.

20. The fashion designer showcased a series of collections, each with its own unique theme and style.

21. The news might be biased, so take it with a grain of salt and do your own research.

22. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

25. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

26. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

27. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

28. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

29. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

2. Heto ako, nakakarinig ng awit at tawanan pero hindi naman nakikita ang katuwaan.

3. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

4. Magpapabakuna ako bukas.

5. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

6. The feeling of finishing a challenging book can be euphoric and satisfying.

7. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

8. No puedo dejar de dar las gracias por todo lo que has hecho por mí.

9. Kung saan ka naroroon, doon ka maglingkod.

10. Comer saludable es esencial para mantener una buena salud.

11. Magsasalita pa sana siya nang biglang may dumating.

12. Hinayaan kong lumabas ang malalim na himutok upang ipahayag ang aking galit.

13. Les banques jouent un rôle clé dans la gestion de l'argent.

14. Ang mga mag-aaral ay nag-aapuhap ng karagdagang oras para mag-ensayo para sa kanilang mga pagsusulit.

15. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

16. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

17. The company's board of directors approved the acquisition of new assets.

18. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

19.

20. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

21. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

22. Ano ang gagawin ni Trina sa Oktubre?

23. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

24. Ang aming kasal ay nagpapakita ng pagkakaisa at pagmamahal sa pagitan naming dalawa bilang magkabilang kabiyak.

25. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

26. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

27. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

28. Eine hohe Inflation kann zu einem Anstieg der Zinsen führen, um den Anstieg der Preise auszugleichen.

29. Omelettes are a popular choice for those following a low-carb or high-protein diet.

30. Gusto ko na umuwi ng Pilipinas.

31. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

32. Ang paglapastangan sa mga indibidwal at kanilang karapatan ay hindi dapat maging bahagi ng isang lipunan na may respeto.

33. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

34. Argh. Parang batang bading naman eh. Anubayan.

35. A, e, nawawala ho ang aking pitaka, wala sa loob na sagot ni Aling Marta

36. Ang pagpapakalbo ng kagubatan ay isa sa mga pangunahing dahilan kung bakit nagkakaroon ng pagkawala ng mga punong-kahoy.

37. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

38. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

39. Ngayon lamang ako nakakita ng dugo na kulay abo.

40. El lienzo es la superficie más común utilizada para la pintura.

41. He does not break traffic rules.

42. Ang diploma ay isang sertipiko o gawa na inisyu ng isang institusyong pang-edukasyon

43. Sa takot ng mga tao sa pagsalakay ng mga tulisan, ibinaon nila ang gong sa isang lugar na malapit sa gubat.

44. Ang mga magulang niya ay pinagsisikapan ang magandang kinabukasan ng kanilang mga anak.

45. Nang malaman ko ang balitang malungkot, hindi ko mapigilang maglabas ng malalim na himutok.

46. Kumunot lang ang noo ko, That's not my name.

47. Hinanap niya si Pinang.

48. He served as the 45th President of the United States from 2017 to 2021.

49. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

50. Wala siyang sapat na budget, samakatuwid, hindi niya mabibili ang gustong cellphone.

Similar Words

gowndownlockdownknown

Recent Searches

individualsabihingowncontent,malapadpropensoleospentbisiggamotcivilizationcigarettesreservedvotessumarapdeathroboticabeneadverselymeetpingganconvertidasreducedfireworkssumindimaalogsobrapumuntaposterencounterballgenerationertransitbumugapyestafonogameitinalimagbungalabasjeromemulaonceplayedyonferrerpinilinginspiredderhasdollardevicespaslitputigrabeplatformsbumabastatuseksenasincenameimaginationjohndraft,andyfoursummitannaevilgenerationsqualityslavefullinteriorcorrectingsquatterconnectionbadingmonetizingneeddevelopprogrammingfallrangelearningablepublishedtwowhethercertainflashmulinglibroawareviewcablenagbiyayapinakamagalingsidonakakunot-noongmakikipag-duetopinagmamalakihumahabatatawagmagagawanagkwentoguitarramasasayamaipapautangpagkaangatpaghaliktaglagashawaiinalalabikalaroconvey,iikutanresearch:kastilaconclusion,minahancashpresencenayonbeforeapologeticbinibiligjortkainsigemeaninginagawbusiness,dollyipinadalaincluirfertilizernilangdilimilalagaylulusogtools,balepakikipagbabagginatumamisitimabstainingcommunicatesambitryanpracticesmaratingpackaginginteligentesknowledgekalikasangumagalaw-galawpagkakapagsalitageologi,pinagsikapanmagkahawakikinatatakotnangagsipagkantahanpagkakatuwaanpinakamaartengkawili-wilipaglalayagkumakalansingnaka-smirknagre-reviewbaranggaynagkitanakagalawpodcasts,napaplastikansundalonagpabayadnagkapilatenergy-coalfollowing,pagtatanongnapapatungonapapasayanakatirangpinahalataikinalulungkotnagtutulakpinapalokabundukanmangkukulampangyayarinageespadahanemocionantepagpilipupuntahannegro-slavesnaglakaddadalawintaga-hiroshima