Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "own"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He makes his own coffee in the morning.

6. He used credit from the bank to start his own business.

7. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

8. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

9. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

10. In this industry, singers who can't write their own songs are a dime a dozen.

11. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

12. Many cultures have their own unique traditions and customs surrounding weddings.

13. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

14. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

15. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

16. Retweeting is a feature that allows users to share others' tweets with their own followers.

17. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

18. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

19. The bag of groceries was too hefty for the elderly woman to carry on her own.

20. The fashion designer showcased a series of collections, each with its own unique theme and style.

21. The news might be biased, so take it with a grain of salt and do your own research.

22. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

25. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

26. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

27. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

28. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

29. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. Matitigas at maliliit na buto.

2. Kaya lumaki si Pinang sa layaw.

3. Ang koponan nila ay mas handa at mas determinado, samakatuwid, sila ang nagwagi sa paligsahan.

4. Sumasakit na ang kanyang sikmura dahil hindi pa rin sya kumakain simula kaninang umaga.

5. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

6. Les enseignants peuvent organiser des activités parascolaires pour favoriser la participation des élèves dans la vie scolaire.

7. Palibhasa ay madalas na may mga kahanga-hangang insights dahil sa kanyang malalim na pag-unawa.

8. Le sommeil est également essentiel pour maintenir une bonne santé mentale et physique.

9. Masarap makipagkaibigan sa taong bukas palad dahil alam mong pwede kang umasa sa kanya.

10. Kinakabahan ako para sa board exam.

11. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

12. Ang aking teacher ay hindi muna nagturo ngayong araw.

13. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

14. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

15. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

16. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

17. Los héroes están dispuestos a enfrentar los desafíos y luchar por lo que creen.

18. Les enseignants peuvent utiliser des outils technologiques tels que les tableaux blancs interactifs et les ordinateurs portables pour améliorer l'expérience d'apprentissage des élèves.

19. Matapos mabasag ang aking paboritong gamit, hindi ko napigilang maglabas ng malalim na himutok.

20. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

21. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

22. Ang kabanata ay nagbigay ng mahahalagang detalye tungkol sa nakaraan ng pangunahing tauhan.

23. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

24. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

25. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

26. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

27. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

28. Mayaman ang amo ni Lando.

29. Has she taken the test yet?

30. ¿Qué música te gusta?

31. Fødslen er en af ​​de mest transformative oplevelser i livet.

32. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

33. Tumatakbo parin ang metro ng taxi kahit nakatigil ito dahil sa matinding traffic.

34. Jagiya? hinde parin siya umiimik, Ya Kenji.

35. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

36. Not only that; but as the population of the world increases, the need for energy will also increase

37. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

38. Ipagtimpla mo ng kape ang bisita.

39. ¿De dónde eres?

40. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

41. Bagaimana kondisi cuaca di sana? (What is the weather condition there?)

42. Ang mabuting kaibigan, ay higit pa sa kayamanan.

43. May isa pang nagpapaigib sa kanya.

44. Palibhasa ay mahusay sa pagbasa ng mga komplikadong mga aklat at materyales.

45. Madalas siyang sumusulat kapag nag-iisa.

46. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

47. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

48. Effective use of emphasis can enhance the power and impact of communication.

49. La labradora de mi colega es muy sociable y siempre se lleva bien con otros perros.

50. She has quit her job.

Similar Words

gowndownlockdownknown

Recent Searches

masayang-masayangownkamalianunacircleilongbutikinikitaginoocelularesalingkunwaprimeraspoliticspusapisonoodmalayanglivesnanghihinamadblesssasamahannatalolasinggeroaroundknowmoderngabeginamotjanekalayaanpalakolculturasisamaorkidyasipagpalitafterpisaraitinatagkanjobskasaganaanmapag-asangdraft:juanitowriting,obstaclespansolpormadridpumapaligidolivaeskuwelapariano-anobumugawalangnaisipgregorianokasayawannikacapablenyanisatilanakapagsabiagadtwo-partyeksaytedsampungopisinaumalissolidifydrawingbukodamericahilingbayarannakakapagpatibayspeedkanyamatagalaffiliatemalumbaykalabawnapakasipagibigproductividadrabenagmamaktoldesigningsmallmagsasalitamariaparangsanopdeltmakapasokbagomimosamagpalagoexperthatinggabipag-uugalimakabangonrosasipanliniskalupibuhaybellmorenaulinigannagsimulajolibeetitahalamagpakasalloskasamaangbungamississippifarprovideleadinghomeputingmobile1960sstateiniibiguminomnagpalipatdidingalas-tresnetotrabahopilipinaskayang-kayangdatinangapatdanhayopkaano-anosellpaslitiiwandaramdaminnag-replykumpletonagwikangteamplatformpakibigyanmaka-alislugarnagsuotbyggetpagkatmay-bahaynotgalitumakyatknowledgemaritesaudiencetungkoldadaangkanpaglakiimpactoresearchpaskoturonalamhumarapdrenadoanumangbighanipangyayariitinuringcountlessanongbatang-batapataymag-aaralsumamakumampidumalonaglabaaeroplanes-allisilangpinigilangospelsultanpusangasongngunitligayahatelumutangkalikasan