Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "own"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He makes his own coffee in the morning.

6. He used credit from the bank to start his own business.

7. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

8. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

9. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

10. In this industry, singers who can't write their own songs are a dime a dozen.

11. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

12. Many cultures have their own unique traditions and customs surrounding weddings.

13. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

14. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

15. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

16. Retweeting is a feature that allows users to share others' tweets with their own followers.

17. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

18. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

19. The bag of groceries was too hefty for the elderly woman to carry on her own.

20. The fashion designer showcased a series of collections, each with its own unique theme and style.

21. The news might be biased, so take it with a grain of salt and do your own research.

22. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

25. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

26. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

27. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

28. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

29. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. Está claro que hay diferencias de opinión en este asunto.

2. Morning.. sabi niya na halos parang ang hina niya.

3. Inflation kann die Beziehungen zwischen den Ländern beeinträchtigen.

4. Ang abilidad na makisama sa iba't ibang tao ay isang mahalagang aspeto ng liderato.

5. Ang sugal ay nagdudulot ng pagkawala ng kontrol at pagkakaroon ng mga labis na panganib.

6. He is painting a picture.

7. Scissors have handles that provide grip and control while cutting.

8. Magandang araw, sana pwede ba kita makilala?

9. Palaging sumunod sa mga alituntunin.

10. Nais ko sanang malaman ang mali sa katotohanan

11. Pneumonia can be prevented with vaccines and by maintaining good hygiene.

12. Maasim ba o matamis ang mangga?

13. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

14. Sobra. nakangiting sabi niya.

15. Nagdala ako ng mga bagong libro sa silid-aralan upang makapagbahagi sa mga kaklase.

16. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

17. Hanggang ngayon, ginagamit ang kanyang mga kontribusyon bilang inspirasyon sa pakikibaka para sa kalayaan.

18. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

19. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

20. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

21. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

22. Tienes que tener paciencia para lograr buenos resultados.

23. Laging kinatatakutan si Kablan sa pagiging usurero sa Palawan, ang pating naman ay lagi ring kinasisindakan sa kabangisan.

24. Tsuper na rin ang mananagot niyan.

25. Pakitimpla mo ng kape ang bisita.

26. Hindi ko mapigilan ang aking inis kapag nakikita ko ang kawalang-katarungan.

27. Bumili ako ng lapis sa tindahan

28. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

29. Nasa kanan ng restawran ang sinehan.

30. La paciencia es una cualidad que se debe cultivar.

31. Nasa harap ng tindahan ng prutas

32. If you think I'm the one who broke the vase, you're barking up the wrong tree.

33. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

34. Hinihiling ko lang sana na sa aking pagpanaw ay kunin mo ang aking puso, sunugin mo, at ilagay sa banga ang abo nito.

35. Hindi ba nagdaramdam ang nanay at tatay mo?

36. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng insomnia o hindi makatulog sa gabi.

37. They are not hiking in the mountains today.

38. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

39. Tumahimik na muli sa bayan ng Tungaw.

40. Jodie at Robin ang pangalan nila.

41. Pinagsisihan niya ang mga desisyon na hinugot niya mula sa kanyang emosyon.

42. Datapwat mali sila ng akala, sapagkat ang anak ay hindi nagbago.

43. Hinila niya ako papalapit sa kanya.

44. Napadungaw ang ina at kitang-kita niya ang pagkasubasob ng anak bago paman ito nakaakyat ng hagdan.

45. Kapag mayroong sira sa ngipin, kailangan ng agarang aksyon upang hindi lumala pa ang problema.

46. Les personnes âgées peuvent souffrir de solitude et de dépression en raison de l'isolement social.

47. He applied for a credit card to build his credit history.

48. Nasa Ilocos si Tess sa Disyembre.

49. Mga bopols! Tape lang hindi nyo pa nagawang makabili!

50. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

Similar Words

gowndownlockdownknown

Recent Searches

ownpagkaingkaawa-awangnabigaysupilinditoataquesnagtatanonghubadmangyayariissuesmadurasgumisinganaotropulakuwadernomalakastitiraanimobumangonnagtatakbolalakingmahaldikyamomelettepublicitypangakoumaapawseasitelumiittrentaluneshumahangoswidespreadmagtatakacolourdirectamemberscellphonerosaspwedememoryninanaismahirapkaarawan,recibirexpandedreducedmayroondagatmedisinapinabayaanforeverscientistbooksmakatidisposalbayabaspakikipaglabanbeintemakesmarynapawipag-irrigatebagsakcombatirlas,tumamisipinanganakkaguluhanelectionssinasadyananghingisusulitmulahitsuraanongdevelopedpokermisyunerolibagtindigmatutulogtitapowersilangosakatactoiintayinhiyasaanmakabilikulangtabaipinagbabawalpetsanakatingintinikmaruminasiyahanhinding-hindimagiginghumalomaynilaatpartehirapapelyidomarkpodcasts,mangingisdakamustanamataygiitskyldes,pagsusulitikawalongtuparinhagdanbroughtcollectionsimportantesimportantemusicales1990alamleadmakakakaennakiramaypunongkahoylakisalu-saloprinsesatandatandangmultonalugidadadoone-bookstools,befolkningen,waitnazarenonobleeconomynasugatanayawalasdumiitutuksoipaghandapakinabanganneroyumabongkinagigiliwangnakagalawcantidadpagkapasanipanlinisifugaonasisilawgawaprutasbopolsmasokkatagalfullsimplengkampanat-shirtdraft,kaininnagkikitakabuhayanlongexpenseslapisdalapalawanklasrumisinagottrajeattorneyibotomadalasminutomalayotalentindvirkningrabekaibigannagdiriwangkapatidmagisingnagdiskotshirtkumampihabangpagkataposdosenang