Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "own"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He makes his own coffee in the morning.

6. He used credit from the bank to start his own business.

7. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

8. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

9. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

10. In this industry, singers who can't write their own songs are a dime a dozen.

11. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

12. Many cultures have their own unique traditions and customs surrounding weddings.

13. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

14. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

15. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

16. Retweeting is a feature that allows users to share others' tweets with their own followers.

17. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

18. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

19. The bag of groceries was too hefty for the elderly woman to carry on her own.

20. The fashion designer showcased a series of collections, each with its own unique theme and style.

21. The news might be biased, so take it with a grain of salt and do your own research.

22. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

25. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

26. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

27. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

28. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

29. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. Maria Rosario Toribio ang buong pangalan ko.

2. Ok ka lang? tanong niya bigla.

3. Le travail est une partie importante de la vie adulte.

4. Napatingin ako sa orasan. 12 na ng madaling araw.

5. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

6. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

9. One man, one word ka ba? Ang tipid mong sumagot eh!

10. Batman, a skilled detective and martial artist, fights crime in Gotham City.

11. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

12. Isang araw nagkasakit si Aling Rosa.

13. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

14. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

15. Malilimutin si Lolo kaya’t lagi niyang hinahanap ang kanyang salamin.

16. Ano ho ang nararamdaman niyo?

17. Kasama ng kanilang mga kapatid, naghihinagpis silang lahat sa pagkawala ng kanilang magulang.

18. Nagkalat ang mga adik sa kanto.

19. All these years, I have been blessed with experiences that have shaped me into the person I am today.

20.

21. Marahil ay nasa ibang bansa ang artista kaya't hindi mo siya maaaring makita sa personal.

22. Ang mga dragon at lion dance ay karaniwang makikita sa mga kalye tuwing Chinese New Year.

23. Emphasis is often used to highlight important information or ideas.

24. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

25. Obvious. tawa nanaman sya ng tawa.

26. Hospitalization can be a stressful and challenging experience for both patients and their families.

27. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

28. Yeah. masayang sabi ni Chad with matching thumbs up.

29. Nag-aalala ako dahil biglaan siyang umalis nang walang abiso.

30. Kapareha naman ni Kangkong ang Sitaw, ni Mangga ang Dalanghita, ni Saging ang Papaya.

31. El diseño inusual del edificio está llamando la atención de los arquitectos.

32. The new restaurant in town is absolutely worth trying.

33. Nag-enjoy ako sa pag-aaral ng isang bagong wika kaya nahuhumaling ako sa pag-aaral ng iba pang wika.

34. Dumating ang pangulo sa pagtitipon.

35. Gusto ko pumunta ng enchanted kingdom!

36. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

37. Nanonood nga muna ito at saka lang bumaba sa nananalong grupo.

38. Gracias por iluminar mi vida con tu presencia.

39.

40. Umutang siya dahil wala siyang pera.

41. Mayroon ka bang kapatid na lalaki?

42. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

43. Hindi niya agad napansin ang sugat hanggang sa sinubukan niyang salatin ito.

44. May nakita ka bang maganda? O kabigha bighani?

45. Setelah kelahiran, calon ibu dan bayi akan mendapatkan perawatan khusus dari bidan atau dokter.

46. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

47. Ang tag-ulan ay isa ring panahon ng pagsusulat, pagbabasa, at panonood ng mga pelikula dahil sa hindi madalas makalabas ng bahay.

48. Matutulog ako mamayang alas-dose.

49. Puwede ba siyang pumasok sa klase?

50. Sa balkonahe ng kanyang bahay sa Kawit, idineklara ang kalayaan ng Pilipinas.

Similar Words

gowndownlockdownknown

Recent Searches

ownisasagotprosesopulisfollowingpolokauntinai-dialmalaki-lakiinantokkapangyarihannaligawkristonaiilanggagamitinpagtangohalamangparusatransmitidasjeepneybossnaiinitankayopamanhikannaiisippalakolarteuwakloobnakatulongnyanaisipwaringsilanghila-agawanexperiencesnaiyakbudokmini-helicopterunitednakabuklattalaganaglakadika-12lobbynearnakalimutankasiyahanvitalknowumagalihimnandoonkulturbalatnakagawiannakakaakitpamamagaagesharingmaasahannakakapamasyalpawisflerenakakapuntadaangiyannakabaongodpinalayasmatigasdon'tkinamumuhianmay-bahaypaligsahannakangisingsamakatwidnakangitiloshumanosmainitipinagdiriwangnakapagngangalitsarilingnanlakialamidopportunitiescoincidencesumayawhinanapnakapagreklamomakikipaglaronakapagsabiyayanyangbikolliboluispagsilbihansupportnamalagisilaysikrer,nakapagusapnahihilonakihalubilocineanak-pawis1954ibinigayjejumaskikonsiyertoimpactsmatatagpinagtulakanumanokaniyamakapasakikilosnaawakaninahinahangaananumannakapilangilaniilannandyanmalabopaggawafar-reachingnakatalungkointernalmasayang-masayawithoutvetokawili-wiliampliaattentionkaagadearnumiibigsupilindamasoduranteigigiitorascurednecesitapinagpalaluangayunpamanutak-biyasamakatuwidmensaheinulitkomunidadnakatuonsourcestiniosusundopropensozookulisappinapakingganmaghanapbagaytamadmakapaibabawmessageiniibigbalitangpagkakilanlantsinamayabongnalalaglagpaladnapapadaannamatayseemahigithinanakitdustpannami-missfistsnatagonag-alalakayahayopnakasunodsamebuongalagacompletingkaybalikiiwannakatapatbumangonkilongnangyari