Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "readers"

1. It can be helpful to get feedback from beta readers or a professional editor

2. Promote your book: Once your book is published, it's important to promote it to potential readers

3. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

Random Sentences

1. Ipinagtanggol ng mga obispo ang doktrina ng purgatoryo sa kanyang homiliya.

2. Det er vigtigt at have relevant erfaring, når man søger en ny jobposition.

3. Huwag kang gagamit ng illegal na droga.

4. Fødslen er en af ​​de mest transformative oplevelser i livet.

5. Masayang kasayaw ng mga Kuneho ang mga Usa, ng mga Elepante ang mga Tamaraw, ng Zebra ang Tsonggo.

6. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

7. Masarap ang pagkakaluto mo ng kare-kare.

8. Kainis ka talaga! sabi ko sabay hampas sa braso niya.

9. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

10. In conclusion, the telephone is one of the most important inventions in human history

11. Baket? nagtatakang tanong niya.

12. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

13. kami kumikilos mula sa kinatatayuan namin.

14. Siempre hay que tener paciencia con los demás.

15.

16. Wala akong pakelam, basta nasa ref ng bahay ko akin!

17. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

18. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

19. Hindi dapat umutang nang labis sa kakayahan ng pagbabayad upang maiwasan ang pagkakaroon ng financial burden.

20. Please add this. inabot nya yung isang libro.

21. Inakalang wala nang natirang pagkain, pero may tinapay pa pala sa mesa.

22. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

23. Eksport af teknologi er en stigende del af den danske eksport.

24. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

25. Isang Saglit lang po.

26. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

27. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

28. Les enseignants jouent un rôle important dans la réussite des étudiants.

29. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

30. Min erfaring inden for dette område har været meget givende.

31. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

32. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

33. Humarap sakin si Nathan, Kumain na ba kayo?

34. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

35. Adequate fiber intake can help regulate the digestive system and maintain gut health.

36. Kalimutan lang muna.

37. The cutting of the wedding cake is a traditional part of the reception.

38. Sinabi ko nang binangga ako nang pasadya, na naramdaman ko ang kanyang kamay sa aking bulsa.

39. We have been cooking dinner together for an hour.

40. Lumapit ang mga katulong.

41. Ano ang gustong bilhin ni Juan?

42. Inakalang magugustuhan ng lahat ang ideya niya, pero tinanggihan ito.

43. Kailangang mabagal at marahan ang apoy.

44. Paano po kayo naapektuhan nito?

45. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

46. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

47. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

48. I used my credit card to purchase the new laptop.

49. We have visited the museum twice.

50. Kung hindi naman ninyo kaya ay sabihin ninyo at tatawag ako ng ibang pulis.

Recent Searches

readersteleviewingapoynagsamainiwanipinasyangomgalamidmagisinglingidpangingimimagtipidmalihisnaglutoproductiontinanggapnaglaholinggogenehmmmmcineroboticnagawanmassachusettsdatapwatdyanna-fundmethodsreducedconvertidassparkmeetingshortmalagosumusunobilinmataposumingitshowsmatalimmaskaramartialsapagkatmakapalsumalagamesmahirapfonoakomahirammamibruceoutpostmagturonaritoreservedmaestroipinabalikavailablebuwalmadalasleadingkontingkingdomkawayankastilakapatiditinaaspoliticalelectroniccandidateofteinspirehelpfulkasinggandabumabapresstuwidiniindatuluyanharmfulinantoktabasprivateimpactocommunicationsiikutanibinaonhumanaphigantehalalanginamitgagambamakingnutsfriendsandyalignsexamplemaratingpointdesign,recentventadahilanbabetaleconvey,himselfbinabacontentconsistclassespusacapablebuwenasbumalikboksingbestidatinapaynapalitangbecomesbasahinbaldengbagyongaksiyonwidelynapilingwalongprocesscomputerformsunahinsolidifybinilingumayoswindowpublisheddumaramitumayoedit:tumamajobsganitotulangthankstennistaingasundaespeechnagsibilisiyangnyosimpelpuwedepuedespasahemagsugalparangparaanpabalingatpancitpadabogpanamapanalopalakaolivianinongnilutonanaognagingmulinglumulusobmotionmaubosmanggamagawalumakilorenalightslibinglaruankumitakumaenkulangkinayakamiaskikokalonglarawankailanjeromeisulatinyonguniversityifugaosonidohumayonovemberhojas,