Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "katandaan"

1. Yumao na ang lolo ko dahil sa katandaan.

Random Sentences

1. Kebahagiaan sering kali tercipta melalui perspektif positif, menghargai hal-hal sederhana, dan menikmati proses hidup.

2. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

3. Ipapainit ko ho ito sa kusinero namin.

4. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

5. Paano mo nalaman? tanong ko sa kanya.

6. Huwag mong hiramin ang aking payong dahil umuulan pa rin.

7. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

8. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

9. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

10. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

11. Ang nagmamahal sa sariling bayan, kayang magtiis at magsumikap.

12. Bakit lumilipad ang manananggal?

13. Kapitbahay ni Armael si Juang malilimutin.

14. Muchas personas utilizan las redes sociales para expresar sus opiniones y puntos de vista.

15. La música en vivo es una forma popular de entretenimiento.

16. Gaano katagal po ba papuntang palengke?

17. Ang mga bayani noon ay nangahas na ipaglaban ang kalayaan kahit na kapalit nito ang kanilang buhay.

18. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

19. The information might be outdated, so take it with a grain of salt and check for more recent sources.

20. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

21. Bumili ako ng prutas sa Berkeley Bowl.

22. Nagkwento ang lolo tungkol sa multo.

23. Maghilamos ka muna!

24. Omelettes are a popular choice for those following a low-carb or high-protein diet.

25. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

26. La tos es un mecanismo de defensa del cuerpo para expulsar sustancias extrañas de los pulmones.

27. Børns sundhed og trivsel bør være en prioritet i samfundet.

28. Elektronik kan hjælpe med at forbedre adgangen til information og vidensdeling.

29. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

30. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

31. Marahil ay hindi pa sapat ang oras na nakalaan para matapos ang proyekto.

32. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

33. Baka puwedeng hiramin mo ang iyong sasakyan para sa isang biyahe.

34. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

35. Dumating ang mga atleta sa entablado nang limahan.

36. Pakibigay ng pagkain sa mga alagang hayop bago ka umalis ng bahay.

37. The zoo houses a variety of animals, including lions, elephants, and giraffes.

38. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

39. Kailangan ko gumising nang maaga bukas.

40. Mahal ang mga bilihin sa Japan.

41. Kung napaaga ng tatlumpung segundo sana ang dating niya ay naabutan pa sana niya ang karwaheng sinasakyan nina Helena.

42. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

43. Makikiligo siya sa shower room ng gym.

44. Inakalang walang interesado sa kanyang alok, pero marami ang tumawag.

45. Las serpientes juegan un papel importante en el equilibrio de los ecosistemas al controlar las poblaciones de roedores.

46. Nagpuntahan ang mga tao roon at hinukay ang ugat ng puno.

47. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

48. Los agricultores pueden desempeñar un papel importante en la conservación de la biodiversidad y los ecosistemas locales.

49. Make a long story short

50. All these years, I have been working to make a positive impact on the world.

Similar Words

pakakatandaan

Recent Searches

kumanankatandaanboyfriendactualidadfestivalesnakatuwaangbalitakaninonghumakbangturismobasketnagtagallumagonakuhaeksempelkanginaeveningdalawapinisilkabuntisanpagngitilumiwagpagsasalitacampaignsnoongnamebagkuspinapataposditopanatagheimaasahanbellbutterflymasasabistonehampopularnagpagawanegrosna-fundpesoleytepnilitjingjinghinukaynagc-cravebironamasyalbulsahuwebeskaugnayanengkantadamayobinigaysupilinbiliotrofriesidiomatumalonpagkakatuwaandaigdigmadalingfrao-onlinesunud-sunuranmaatimpulangpasswordabonopagpapakilalapinunitkumakaininspirevidtstrakttog,electmakauuwiultimatelylakadnananaginipkumalmanananaghilinagtakakongbiggestbasahinbasahanlackorugare-reviewmagkakagustopaslitalapaappumuntataletomorrowkinalakihankumikilosnagmungkahibereticaketubigpayapangpolosong-writingbumubulainaabutanmalamangkayomagdalatinahakpapayaresignationnitostaplediyosikinamataysalesngumitimayamankasayawgamithalakhakmakikinigparticipatingsino-sinooperatenotebookgymngunitaayusinwritepokerdesarrollarongatheringipaliwanaglihimmumuracaraballokapangyarihanangkopsalbahehastagayunpamanpinabayaannunotirahannag-aaralroofstockaeroplanes-allsanademipinadakiptelefonernapakasipagbumangonhapag-kainaninfinitydoubledinadaananhiligbaldengrequiremahalinhapdinakasimangotbayadsakamaka-alismassakitpulispinangaralannakasandigkeepingproblemamagkaibatotoodyipnitaga-hiroshimakagabimissionganitoisinuotkatulonggloriakinagagalakamparogayunmantv-showspicsmangkukulamnegro-slavesjobsnagtaposbilinbanalgreatperwisyo