Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. Ang pagkakaroon ng sapat na kaalaman at impormasyon ay nagpapawi ng mga agam-agam at kawalang-kasiguruhan.

2. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

3. Naku di po ganun si Maico. automatic na sagot ko.

4. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

5. May dalawang kotse sina Dolly at Joe.

6. Muling nagsimula ang rebolusyon sa pamamagitan ng magkaibang bansa.

7. The guilty verdict was handed down to the culprit in the embezzlement trial.

8. Naidlip siya at nang magising, nakita niya ang magandang dilag.

9. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

10. Wala kang kuto noh? nabigla ako ng magsalita sya.

11. Musk has faced controversy over his management style and behavior on social media.

12. Tumango ako habang nakatingin sa may bintana, Ok. Sige..

13. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

14. Les patients peuvent être autorisés à quitter l'hôpital une fois leur état de santé stabilisé.

15. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

16. En sund samvittighed kan hjælpe os med at tage ansvar for vores liv og handlinger.

17. Ni lumapit sa nasabing puno ay ayaw gawin ng mga taong bayan.

18. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

19. Mabuti na rin ang nakatapos ng pag-aaral upang pagdating ng panahon ay magagamit mo ito.

20. You're stronger than this, pull yourself together and fight through the tough times.

21. Kaninang bandang alas-diyes ng umaga.

22. Imbes na gamitin ang pana para kay Psyche, ay pinabayaan niya lamang itong mamuhay ng normal at tumaliwas sa utos ng ina.

23. Magaling na ang sugat ko sa ulo.

24. Oscilloscopes have various controls, such as vertical and horizontal scaling, timebase adjustments, and trigger settings.

25. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

26. Ilang kutsaritang asukal ang gusto mo?

27. Ang buhawi ay maaaring magdulot ng malawakang pinsala sa mga ari-arian, gusali, at mga taniman.

28. The management of money is an important skill that can impact a person's financial well-being.

29. Ano ang natanggap ni Tonette?

30. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

31. Alin ang telepono ng kaibigan mo?

32. The project is on track, and so far so good.

33. The river flows into the ocean.

34. Some ailments are preventable through vaccinations, such as measles or polio.

35. Emphasis is often used to highlight important information or ideas.

36. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

37. Dun na nga raw pala tayo dumeretso sabi ni Tita Andrea.

38. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

39. Magkano ang arkila ng bisikleta?

40. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

41. Para sa malilimutin, malaking tulong ang paggamit ng alarm sa cellphone.

42. Sa malamig ngunit maliwanag nang sikat ng araw, nakikita na niya ang langkay ng mga agwador.

43. Siya ay nagpunta sa simbahan, lumuhod, at nagdasal.

44. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

45. The elderly man was happy sitting on his porch, watching the world go by - sometimes ignorance is bliss in old age.

46. Tak ada gading yang tak retak.

47. Natutuwa ako sa magandang balita.

48. Ang mga natatanging likhang-sining ay dapat na itinuring bilang mga obra ng kahusayan at katalinuhan ng mga artistang naglikha.

49. Fra telefoner til computere til tv'er, elektronik har revolutioneret måden, vi kommunikerer og får adgang til information

50. If you think he'll lend you money, you're barking up the wrong tree.

Recent Searches

kenjimaghahandahastagymenergynatulakngipingnewspaperspaketetoretekambingsikipheartbeatmaubosbinibinikinahuhumalingandawwestmestreaderskablanroomultimatelyitongsiempretonightadversekinausapdreamelvisbeautyconditioningpogibahalamapayapaboarddecreaseandroidtinydevelopmentbehaviorstartedthreeaffectpacetipssalapilumiwagmaglalaropamahalaannegosyanteclubpagsumamonagmamadalikapatawaranespecializadasreserbasyonkalakihantumawagnakaka-inpaglalayagarghgupitnagpapaniwalanagpakitaunibersidadnakagalawnagtitindanagkakatipun-tiponbiocombustiblesgumagalaw-galawdevelopedtumabidalagarepublickutobisigchickenpoxnakisakaysalamintandangnavigationpagbabantatinuturototoodiinmaasahannatatawacultivationunidosumigtadipinatawagumiinomiloilofitnessikukumparanauliniganmagulayawparehongcourtmagkaibangnagmistulanghumiwalaynakapaligidkare-kareminamahaltiktok,pinalambotikawtaksiumulanmaya-mayadescargarhinugotprotegidokilaymaibigayoperativosumiwaspagongunantiemposkulangmalagosagotnilalangsumasaliwmauntogganyanplanning,anubayansementocandidatesipinansasahogdealtransportmatulungindyosakontingkriskaheartbreakmissionkuwebatokyovivasapilitangmatitigasnegosyomatayoginiisipmakulitmaisiptagalogdikyamdumaanibinalitangeclipxewastemayamanibinentaplasamanghulimatabangkumatokiniibigrenatosuccessfulisinumpapalibhasapagkaraalananumerosostwitcheffektivtillcinetiketokaybinulongmustsigahayhomestwo-partyindiainulitballcompartenfonocongratsdesdeearlymulispecializeddogshowroboticvotesdolyarbalde