Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

2. Nakain na nito ang lasong bunga at unti-unti na itong nangingisay at bumubula ang bibig.

3. Pininturahan nila ang bahay ng puti upang magmukhang maaliwalas.

4. Kailangan mong umintindi ng kaibuturan ng kanyang pagkatao upang magkaroon kayo ng mas malalim na ugnayan.

5. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

6. Microscopes have played a critical role in the development of modern medicine and scientific research.

7. Tesla is an American electric vehicle and clean energy company.

8. Lalo itong nalungkot nang malamang magdaraos ng isang handaan ang Adang kagubatan.

9. I used a traffic app to find the fastest route and avoid congestion.

10. Tumingin siya sa wrist watch niya saka nag-isip.

11. All these years, I have been grateful for the journey and excited for what the future holds.

12. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

13.

14. For nogle kan fødslen være en åbenbaring om styrken og potentialet i deres egen krop.

15. The title of king is often inherited through a royal family line.

16. Sa mga gubat ng Mindanao, may mga punong-kahoy na may napakalaking kahoy at tinatawag itong "Lauan".

17. Saan mo dinala ang dinukot mo sa aling ito?

18. Ang mumura ng bilihin sa divisoria.

19. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

20. Confocal microscopes use laser technology to create 3D images of small structures.

21. No hay que buscarle cinco patas al gato.

22. Tuwing may sakuna, nagkakaisa ang mga Pinoy sa pagtulong sa kapwa.

23. Di natagalan, isinawak niya ang kamay sa nalalabing tubig sa balde.

24. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

25. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

26. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

27. No choice. Aabsent na lang ako.

28. A couple of students raised their hands to ask questions during the lecture.

29. Elle peut être interne, c'est-à-dire provenant de soi-même, ou externe, provenant de l'environnement ou de la pression sociale.

30. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

31. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

32. Forgiveness requires a willingness to let go of the desire for revenge or retribution and choose compassion instead.

33. Nagsusulat ako ng tula bilang pagpapahayag ng aking damdamin.

34. La labradora de mi vecino siempre se emociona cuando ve a alguien llegar a casa.

35. Risk tolerance is an important factor to consider when deciding how to invest.

36. Sa mga kasal, kadalasan ay mayroong programa ng sayawan upang mas masaya ang pagdiriwang.

37. Magsasalita na sana ako ng sumingit si Maico.

38. Sa harap ng tore, natatanaw ko ang ganda ng arkitektura at kahalagahan ng kasaysayan.

39. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

40. Viruses are small, infectious agents that can infect cells and cause diseases.

41. May I know your name for networking purposes?

42. Ang malalakas na hagupit ng hangin sa gitna ng bagyo ay binulabog ang mga puno at nagdulot ng pagkasira sa mga istraktura.

43. L'accès à des soins de santé de qualité peut avoir un impact important sur la santé et le bien-être des populations.

44. The children are playing with their toys.

45. Ikaw ang iniisip ko bawat oras ng buhay ko.

46. The king's role is often ceremonial, but he may also have significant political power in some countries.

47. Wie geht's? - How's it going?

48. Lazada has a strong focus on customer service and has won awards for its efforts.

49. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

50. Les entreprises cherchent souvent à maximiser leurs profits.

Recent Searches

hastaenergyhistoriasmagtataposdahilsinikaprightpilinghopethankpagkatprosesokubonag-aalaysafefeedbacknagagandahankaaya-ayangnagmistulangnakikitangumiinitpintuannapaluhanahawakannoonisinaboysikatradiotuwangharapallottedmanuscriptpatingpamamasyalnagkwentotumabanalalabinakakagalapaki-translatemakauuwiisinulatnapapatungonuntumawaactualidadpagkaangatmagsugalmagagawamedisinapinasalamatanguitarrapaki-drawingnanghihinamadnagliliyabmaglalakadnangagsipagkantahannewnaibibigaymakatatlokabundukanentrancebestfriendpinaghatidansasagutinnaglakaddumatingpakaininomfattendedakilangpanatagmahigitbarongcommerciallugawbankperyahanleonakahainpakakasalanlumagopaulit-ulitkilongsiksikanpaghuhugasconectadospagtayomagbigaypalasyotiyakmagisipmangingisdangiikutanjosiekastilangcombatirlas,kaymalimitpulapasokexperiencessoonsumakitsumasambaotrassinipangcommissionkanmarangalpinisiljulietconvey,pasahepalantandaanbinitiwanincitamenterniyogdaddylastingpracticadoechavetwinklepromotingvasquesdrewtandajobmanilakutodpagdamigjortdespuescashsiranayonsagotkasitanongisanilulonsigenapatingalabevareiniinomsinampalexhaustedfauxsignhesusrosellepatunayanapoyumaliskasakitnogensindehelpednaishisfe-facebookpartynatanggapmagpuntameaningestarbecomefreeblazinglaryngitishimaddictionformscomputerneedsmapsetswindowsummitryanprovidedmakaangalbustenerkumaliwaawanakakarinigalas-diyesnuclearateandagamagsungitotroabatuloytumatanglawinalalayansalatkarapatannagwagibuslomakabili