Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. Walang tutulong sa iyo kundi ang iyong pamilya.

2. Magkano ang arkila kung isang linggo?

3. Napansin ng Buto na nagsipagtago ang mga hayop sa mga kuweba.

4. Las hojas de otoño son muy bonitas en la ciudad.

5. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

6. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

7. The Niagara Falls are a breathtaking wonder shared by the United States and Canada.

8. Ang pagkakaroon ng kinikilingan sa kabila ng malinaw na ebidensya ay nagpapahiwatig ng pagiging bulag sa katotohanan.

9. Ni lumapit sa nasabing puno ay ayaw gawin ng mga taong bayan.

10. Hindi na nakita ni Aling Rosa si Pinang.

11. Denne kombination har vist sig at være meget effektiv i at skabe en høj grad af velstand og velfærd for befolkningen

12. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

13. Isang araw sa kainitan ng tanghali, isang mahiwagang babae ang dumating at kumatok sa mga pintuan ng mga taong bayan.

14. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

15. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

16. Sumang ayon naman sya sa mungkahi ng kanyang kasintahan.

17. Mahina ang tulo ng tubig sa kanilang pook.

18. Nasawi ang drayber ng isang kotse.

19. She admires the philanthropy work of the famous billionaire.

20. The acquired assets will give the company a competitive edge.

21. Nakita ni Juan ang paparating na bus kaya’t kumaripas siya para maabutan ito.

22. No hay palabras suficientes para agradecer tu amor y apoyo.

23. He blew out the candles on his birthday cake and made a wish.

24. Bakit niya gustong magpahaba ng buhok?

25. Ang labi niya ay isang dipang kapal.

26. Sí, claro, puedo confirmar tu reserva.

27. Air tenang menghanyutkan.

28. Las labradoras son perros muy curiosos y siempre están explorando su entorno.

29. There are a lot of opportunities to learn and grow in life.

30. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

31. Nous avons embauché un DJ pour animer notre soirée de mariage.

32. Ang carbon dioxide ay inilalabas ng mga tao.

33. Terima kasih. - Thank you.

34. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

35. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

36. Nangangako akong pakakasalan kita.

37. Hiram lamang natin ang ating buhay sa Diyos.

38. Naka color green ako na damit tapos naka shades.

39. The photographer captured the essence of the pretty lady in his portrait.

40. The cough syrup helped to alleviate the symptoms of pneumonia.

41. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

42. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

43. Isang makisig na binata na halos kaedad din ng magandang prinsesa.

44. Børns sundhed og trivsel bør være en prioritet i samfundet.

45. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

46. May luha siya sa mata ngunit may galak siyang nadama.

47. Dancing all night at the club left me feeling euphoric and full of energy.

48.

49. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

50. Håbet om en bedre fremtid kan give os motivation til at arbejde hårdt.

Recent Searches

anghelhastakailanpareaddictionangalwinspiratasundhedspleje,jobmagbigayanaminsinesusiiligtasinterestspresyopakealamnatandaanhusosangpancitnakapuntabugtongproblematelangdiamondsweetnumerosasavailableconvertidasroonbansaendingreservedbranchescementedateoverviewnowschedulekonsentrasyonsamutuluyantinakasanpagamutanpagtutolharapanpangulonapansinmagtatakanatutulogkenjiprobablementedoganimnagkalapitlabing-siyamnapabayaanprogressinilabastumapospahabolkutsilyotripglobalisasyonnakakasamapagkamulatibinubulongmalungkotnakaluhodnagbabakasyongawaingsiguradoikinatatakotpagsasalitakongmaglaronalamankadalaslipatmaka-alismatagpuanlumakinakaangatinstrumentaltindahanalagangsasapakinmabigyanisinarainalagaanmaalwangdespuesfederalmaatimlupainmakukulaybutterflyipinansasahogilognasasakupaninantaytindaandoygownbaguioquarantinewineiniibiggiverhagdanpagsalakayalexanderpaghingixixmayabanginantokorugaamerikaboteduonkumalantogkahoyproduceherundergranzoomfakeayudakalanpumuntaresearch:increasinglyemphasiswealthperfectcalambaemailpookmagbabakasyonmasarapilangcontinueimpactedtermmind:crazyqualityinterviewingcallingandremenukulangsakalingnagbabagamagtanimiconicgitnamataaspisarapinipilitexampleproudkanayonjerrykapilingmarangyangjejukumikiloskamitshirtfearinterestnauliniganpagkamanghadawtataysiglacampkamoterelevantentrynamilipitintramurosbroadma-buhayarghmasasamang-loobnakaingitararawnungalinbayaranpasanmariamawalamatagalamoy