Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. The invention of the telephone and the internet has revolutionized the way people communicate with each other

2. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

3. Hindi ko alam kung bakit hindi mo na gustong makipag-usap sa akin.

4. Hinintay lamang niya ang aking pagdating.

5. Tsuper na rin ang mananagot niyan.

6. The company's losses were due to the actions of a culprit who had been stealing supplies.

7. Einstein's work led to the development of technologies such as nuclear power and GPS.

8. Ano ang gustong bilhin ni Juan?

9. Ano-ano ang mga nagbanggaan?

10. He is having a conversation with his friend.

11. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

12. The acquired assets included a portfolio of real estate properties.

13. Wala yun, gusto ko rin naman sanang pumunta dito eh.

14. Puwede makita ang schedule ng biyahe ng bus?

15. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

16. Wag ka na lang pumunta sa Palawan. aniya.

17. Siguro matutuwa na kayo niyan.

18. Ang mga batas tungkol sa paggamit ng droga ay mahalaga upang maiwasan ang mga krimen na may kinalaman sa droga.

19. Binili niya ang bulaklak diyan.

20. Emphasis is often used to highlight important information or ideas.

21. Ang edukasyon lamang ang maipapamana ko sayo.

22. Pagkatapos pumili ng lugar, dapat mong magsimula sa pamamagitan ng pagpapakalat ng compost o fertilizer sa lupa bago magsimula sa pagtatanim

23. Después de hacer ejercicio, me gusta darme una ducha caliente.

24. Les écoles offrent une variété d'activités parascolaires telles que le sport, la musique et le théâtre.

25. Ano ang nasa ilalim ng baul?

26. Kaano-ano mo si Juan Dela Cruz?

27. Dalawampu't walong taong gulang si Paula.

28. Lagi na lang lasing si tatay.

29. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

30. Nag-aaral ako para sa aking mga eksaminasyon, bagkus ang mga kaibigan ko ay nag-aaya ng lakad.

31. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

32. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

33. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

34. La santé sexuelle est également un élément important de la santé globale d'une personne.

35. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

36. Ok. Alam mo, isa pa yung excited na magka-apo eh.

37. Pupunta si Pedro sa unibersidad.

38. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

39. Elektronik er en vigtig del af vores moderne livsstil.

40. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

41. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

42. Nangangaral na naman.

43. They go to the movie theater on weekends.

44. Ang pagtanggi sa mga paniniwala at opinyon na hindi pabor sa sarili ay nagpapakita ng pagiging bulag sa katotohanan.

45. The President is elected every four years through a process known as the presidential election

46. Tulad ng dapat asahan, bumuhos na ang malakas na ulan.

47. Al usar un powerbank, es importante seguir las instrucciones del fabricante para un uso seguro y adecuado.

48. Kapag bukas palad ka sa iyong mga pangarap, mas madali itong makamit dahil hindi ka nagtatago sa mga taong pwedeng magbigay ng tulong.

49. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

50. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

Recent Searches

hinabolmaliliithastadadalokabarkadanagtuloymaligotanganparoroonamaghahandabagamakamiedukasyonnagwagisamakatwidrichhitsurananahimiknakahigangkahaponmakatarungangnagnakawpagkakatayonageenglishkumbinsihincultivonakabulagtangkahirapannakitanakakadalawtumatanglawnaglahonapatulalanami-missmagkasabayyumaomasyadongpakikipagbabagmakatulogmananalomahinogaktibistanakaraankanikanilangtiliwonderganunflamencotransporthinanapisubonatutuwahunihuertosuriinligayanagsimulatirangjeepneysinehannglalabaamuyinnagyayangnatitiyaknanamansementongusuariomakawalamarketingfactoresnahahalinhanlumindolpaykalanoueflexibleklimatinglaborexamipagamotbroughtrelocommunitykamatisbriefgabrielsundaesoundgagoutlinekinsealamidautomationkabuhayanherramientapitumpongnatalonginakyatmatabangdalawitongburmanumerosaspopcorniskocassandraasthmanakapuntatsesupremehugisseniormanuksosinunodetoinfluentialfinishedsumalidevicesgodhankumarimotroboticreservationknowsformassumaliwgapattackprogressbetaawareeffectsestablishedcreatingflyreadingdingginsteervistipidsantopumilismokingmunangkumalmakamisetainyopaalisricabecomingakalaingriconatutonaiinggittarangkahan,hinandenreallylakadtagaroonmatagal-tagalbaldengfluidityboracaykawalpagsidlandegreesnaramdampinagwagihangmininimizeiloiloschoolkwebarektanggulomarionagpaiyakdeathdatastonehamipinamilihundredsapilitangna-fundmuntinlupapinapakainabalagitaranaalalakulungankandoyspreadlayuanchessbeersubalitbaboytv-showshandaanlimahan