Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. Tanging edukasyon lamang ang pag-asa nating mahihirap.

2. Mahilig sya magtanim ng mga halaman sa kanilang lugar.

3. Athena.. gising na. Uuwi na tayo maya maya.

4. Nagkalat ang mga balat ng prutas kahit saan.

5. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

6. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

7. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

8. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

9. Ang poot ay parang apoy na unti-unting umaalab sa aking loob.

10. Bata pa lamang ay kinakitaan ng ito ng husay sa larong chess.

11. Pinagpalaluan ng bayan ang kanilang mayor dahil sa kanyang mga proyekto at serbisyo publiko.

12. Hindi ka sigurado sa desisyon mo? Kung gayon, pag-isipan mo itong mabuti.

13. Masyado akong matalino para kay Kenji.

14. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

15. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

16. El internet es una fuente de entretenimiento, como videos, juegos y música.

17. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

18. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

19. Las redes sociales son una plataforma para compartir fotos y videos.

20. Nakipagtagisan sya ng talino sa kapwa estudyante.

21. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

22. Psss. napatignin ako kay Maico. Naka-smirk siya.

23. Nangyari ang isang malaking proyekto sa aming lugar dahil sa bayanihan ng mga residente.

24. The Lakers continue to be a dominant force in the NBA, with a dedicated fan base and a commitment to excellence on and off the court.

25. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

26. Pang-isahang kuwarto ang gusto niya.

27. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

28. The officer issued a traffic ticket for speeding.

29. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

30. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

31. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

32. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

33. The executive branch, represented by the President of the United States, is responsible for enforcing laws

34. Napapagod ako sa bigat ng poot na umaabot sa aking kalooban.

35. Inihanda ang powerpoint presentation

36. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

37. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

38. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

39. Sang-ayon ako sa panukalang ito dahil makakatulong ito sa mga nangangailangan.

40. May lumabas umanong bagong sakit na dapat pag-ingatan ng publiko.

41. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

42. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

43. She has been running a marathon every year for a decade.

44. Nabasa mo ba ang email ko sayo?

45. Isinalaysay niya ang pagkapasan sa krus upang iligtas lamang ni Hesus ang mga makasalanang tao sa daigdig.

46. Kinuha nito ang isang magbubukid at agad na nilulon.

47. Las escuelas también pueden ser religiosas o seculares.

48. Kailangan ko umakyat sa room ko.

49. Gaano karami ang dala mong mangga?

50. Nagsasama-sama ang mga Pinoy tuwing Pasko para magdiwang.

Recent Searches

hastabinasanagmistulanginantoknaggalaikinagalitkakaibatinangkamaghahatidposporonakakapagpatibayvidtstraktnanangiskontrataagaw-buhaypesopalakaaddictionangalmatchingpumuntataga-hiroshimamuchasinalisqualitytwoentrycakesulingansiguradonagsamakampeonmagsungitmasaktannakitulogpicturesnakakaanimmusicalesevolucionadomaglarolumabasyatah-hoygripopagkattenerwaterpinagmagigitingbandafavorbilangintasakomunidadhelpedganitopelikulaalakikinatatakotwalkie-talkiebridesponsorships,namulaklakpagpasensyahanadangsalamangkerokasaganaannakaka-inpagpapatubonakakatulongpinagtagposalu-salonaglalatangbigaydiyanmakasilongskills,kinakabahannabubuhaykumaliwamakapagsabinakalagaykapatawarancultivarmakahirammagtakakanginakalayaankaklasepinigilanlondonbalahiboapatnapumagpahabakumalmapamasahehayaangdyipnipaghaharutanforskel,nangahasumiinomromanticismonakakarinigmahuhusaymagtataasmagkamalimakikiligona-suwayyumabongdireksyonsugatanginiiroginiresetaginagawatradisyongumigisingpropesormaghilamosnabuhayhahahamagawavanjansarongretirarbinabaratrequierensasapakinmatandangininomsumalakaybilihinlalamukahmmmmarteslaroapoycombinedpuwedesonidosaraiskedyulhappenedsellingcocktailsabogmerchandiseshoppingmagsaingsayapatongkasimalawakpulong11pmsnobpinyaramdamexcusemarioclientsnagbasabukodcapitalmenoswaritaga-ochandomatustusanmarahasngayongschoolsso-calledbillsobrawatchingpedropinalutobalingmulighedsamfundcontent,hearspeedagilityvedanimacadamiatransparentimaginationlarrynagreplydaticafeteriacuentanblesslabananmind:divides