Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. Eating healthy is an important way to take care of your body and improve your quality of life.

2. Ang aking kabiyak ay ang aking kaligayahan at kabuuang kaganapan sa aking buhay.

3. Ang debate ay ukol sa mga isyu ng korapsyon sa gobyerno.

4. Taga-Hiroshima ba si Robert?

5. Psss. napatignin ako kay Maico. Naka-smirk siya.

6. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

7. Puwede bang pahiram ng isang kutsara? Nakalimutan ko ang aking sa bahay.

8. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

9. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

10. Umulan man o umaraw, darating ako.

11. A, e, nawawala ho ang aking pitaka, wala sa loob na sagot ni Aling Marta

12. Limitations can be addressed through education, advocacy, and policy changes.

13. Sa panahon ng tag-ulan, naglipana ang mga lamok sa amin.

14. Emphasis can be used to create rhythm and cadence in language.

15. Ang sigaw ng matandang babae.

16. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

17. Protecting biodiversity is important for the health of ecosystems and the survival of many species.

18. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

19. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

20. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

21. Hindi ko masikmura ang pumatol sa walang kalaban laban.

22. A couple of actors were nominated for the best performance award.

23. Coffee shops and cafes have become popular gathering places for people to socialize and work.

24. La comida mexicana suele ser muy picante.

25. At blive kvinde kan også betyde at finde sin plads i samfundet og i verden.

26. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

27. Marami sa atin ang may mga pangarap sa buhay na nais nating tuparin.

28. Tanggapin mo na lang ang katotohanan.

29. Women's rights movements have fought for gender equality and greater opportunities for women.

30. At blive kvinde kræver også mod og selvstændighed.

31. High blood pressure can be managed effectively with proper medical care and self-care measures.

32. Online traffic to the website increased significantly after the promotional campaign.

33. Kapag ako'y nag-iisip nang maayos at walang stress, ako'y nakakamit ng isang matiwasay na pag-iisip.

34. The lightweight construction of the bicycle made it ideal for racing.

35. En España, el cultivo de la vid es muy importante para la producción de vino.

36. Ang magalang na tindero ay laging may malalim na respeto sa kanyang mga kostumer.

37. The momentum of the wave carried the surfer towards the shore.

38. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

39. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

40. Nagtalaga sila ng mga dibisyon kung saan maninirahan ang bawat hayop.

41. Tatlong linggo kami dito sa Pilipinas.

42. Matagal nang hindi niya nabanggit ang pangalan ng kaibigan niya, kaya parang naglimot na siya rito.

43. Sa tuwing mag-iisa ako, naiisip ko ang aking mga kaulayaw na nasa aking tabi.

44. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

45. Ang nagliliyab na araw ay nagdulot ng matinding init sa buong bayan.

46. Receiving good news can create a sense of euphoria that can last for hours.

47. Bibili rin siya ng garbansos.

48. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

49. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

50. Ang matanda ay nagalit at pinalayas ang bata.

Recent Searches

hastafiverrbalangbateryakindspanindangmatulistuvonasandefinitivokatapatdeletingasiaticpeppybevarehitiktiniosumakaylarotapeparkingbinilhanubokinsenahihilogagtenspendingflexiblelabingbinigyangsparkhydelipagbilimisabriefanotherleytemesangbolatekstmayinalisipasokgracefinishedadvancedakoiniscomplicatedexperiencesbinabaandetresponsiblespeechemphasisbadtruesutilinterpretingtoosincenuclearellenatarecentprotestawouldwhyfigurenerissamagbubungaamingcouldbehalfstagelikelywritememorydatastartedhatedependingguideeditilingclassmateeithernamungamababangisgataswaringmamalasluzbasketboldescargarbotochristmasshetthumbsnakakatulongdiwataritwalhetotuwang-tuwagisingkomedorthemsantogutomhankasaganaaninaapimay-bahayprogramavitaminmahigpitpampagandakamag-anaknatatanawipinangangaknasisiyahanmagbayadpaghalikfactoreskumakalansingpaskongbaranggaypinagalitanpagpapautangmagbabagsikmadamotpagigingwellnaglokotilihinintayliligawantuyokinanakinigtiningnansasambulatkaarawanbinatakanayipatuloytomaratinnilutovariousjaceefforts1980postcardpshatentoinantokbakitmuliotherramdampakikipagbabagyarinag-aralranaydispositivojuegosbwahahahahahamagpapigilhawaiiuulaminpagsahodkumakainamountlasingcommunicatestoplightservicesniceextraqualitylinavelfungerendesidohatinggabijolibeegasmenperseverance,sisentahoweverwaysvisfuncionesfatalprofessionalalemaaringhandaannalugmok