Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

2. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

3. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

4. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

5. Magtatanim kami ng mga puno sa isang linggo.

6. Diving into unknown waters is a risky activity that should be avoided.

7. Les soins de santé de qualité sont un droit fondamental de chaque individu.

8. The early bird gets the worm, but don't forget that the second mouse gets the cheese.

9. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

10. Hindi tayo sigurado/nakatitiyak.

11. Payapang magpapaikot at iikot.

12. Biglang nagulat ang bata nang lumitaw sa harp niya ang isang duwende.

13. The elderly are at a higher risk of developing pneumonia.

14. Saan nagtapos ng kolehiyo si Peter?

15. Ano ang sukat ng paa ni Elena?

16. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

17. Nakakapagod pala bumaba ng bundok.

18. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

19. Pinakamatunog ang tawa ni Ogor.

20. Umuuwi siya sa probinsiya linggo-linggo.

21. Ano ang naging sakit ni Tita Beth?

22. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

23. Nakatingala siya kay Ogor, mahigpit na kinukuyom ang mga palad.

24.

25. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

26. Sumama ka sa akin!

27. Gusto mo ba ng isa pang tasa ng kape?

28. A wife can be a source of emotional and physical intimacy for her husband.

29. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

30. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

31. Napansin ng kanyang mga kaibigan na maramot siya sa pagpapakita ng emosyon.

32. Scientific evidence has revealed the harmful effects of smoking on health.

33. Ako ay nagtatanim ng mga succulent plants sa aking munting terrarium.

34. "A barking dog never bites."

35. Ang mailap na kahulugan ng salita ay kailangan unawain nang mabuti.

36. Gusto ko na mag swimming!

37. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

38. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

39. Magkasamang tutungo sa lugar na walang sakit, walang gutom, walang hirap.

40. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

41. Opo. Iiwasan ko po si Anthony. putol ko sa sinasabi niya.

42. Nasaan si Mira noong Pebrero?

43. Ang bilis natapos ng palabas sa sinehan.

44. Kung sino ang maagap, siya ang magandang kinabukasan.

45. Kaya kahit nang dalhin ko siya sa isang karnabal, isa lamang ang ninais niyang sakyan.

46. Habang tumatakbo siya, tila lalong palayo ang kanyang mga pangarap.

47. Ang mga estudyante ay pinagsisikapan na makapasa sa kanilang mga pagsusulit upang maabot ang kanilang mga pangarap.

48. Hindi ako sang-ayon sa pamamaraan na ginagamit mo upang maabot ang iyong mga layunin.

49. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

50. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

Recent Searches

hastadisyembreanitofithundredkape1000granadataasfertilizerbotesubjectsakinrecentlyjacky---winsfaktorer,faroverviewtvsmalapitplatformmulingfourgenerabanagliliwanagnakakapamasyalnakakunot-noongmagbagong-anyounattendednaiilaganmaipagmamalakingcultureyoutube,utak-biyatatayonaiyakkabundukanyorkvarietynagtataeskills,tabinapapatungomagkaparehokumakalansingnagagandahansalu-salonagtagisansasagutinnapakamotnagsagawanakuhangnakasahodnahuhumalingnagpaiyaknapakahusaytobaccolinggongtagaytaypagkaraapawiinhalu-halomedicinemedikalilanshouldpaparusahankanlurankolehiyosistemaskulungansaan-saantungkodnanaloarbularyonapapansindecreasedpinipilititinaobpropesornabasadamdaminisasamagubatpaaralanmemorialmarsonakatawagculturesisinuotkulturmagamottinungorodonaipinauutanglansanganisuboriegavegasnapadpadengkantadakapalbanalmoneylaganapaffiliateikinagalityumaobuwayanapadaanturontelatilaindependentlyrepublicanidiomapulongsusiculpritexpresankasal1960sofrecenmakinangbumilipangkaticonssagapdefinitivotiningnanmagbigayancarbonmaidaksidentenakapaligidkapainiloilodaladalaailmentsbansangfrescotsakabingisupilinanaykaarawanwalngpiecesdreampinatidaywanbinigaysiyamapaibabawpangingimitryghedwalisulamimportantescriticsfurycongressmaitimshowsfansvideorhythmfireworkselectionpasangstevemuliperlapalayanmapakaliencounteradvancedborngracesumangipinagbilingkartonipongsimplengupworkstopandyrepresentedenforcingtelevisednothingnag-replywindowinitbatalearningcomputerinaapikasing