Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

2. Nasa ilalim ng silya ang payong ko.

3. El que busca, encuentra.

4. Marahil ay magpapasko na kaya't maraming tao ang nagpaplanong bumili ng mga regalo.

5. "A dog is the only thing that can mend a crack in your broken heart."

6. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

7. Work can also provide opportunities for personal and professional growth.

8. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

9. Mahirap kalabanin ang sakit na nagdadala ng agaw-buhay na pakikibaka.

10. Sumakay ako ng taksi papuntang airport.

11. Nagbuntong hininga sya, Akala ko naman.

12. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

13. Ang lugaw ay dumikit sa palayok at nasunog.

14. The news might be biased, so take it with a grain of salt and do your own research.

15. Keep studying and hang in there - you'll pass that test.

16. Es importante que los gobiernos tomen medidas para ayudar a las personas pobres.

17. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

18. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

19. Mens nogle mennesker nyder gambling som en hobby eller en form for underholdning, kan det også føre til afhængighed og økonomiske problemer.

20. I can't access the website because it's blocked by my firewall.

21. Ang pag-asa ay nagbibigay ng mga solusyon sa mga suliranin sa buhay sa tulong ng pananalig sa Diyos.

22. The students are studying for their exams.

23. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

24. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

25. All these years, I have been striving to be the best version of myself.

26. There are many different types of microscopes, including optical, electron, and confocal microscopes.

27. Marami nang nakapaligid sa kanila, mga batang nagtitinda, lalaki at babaing mamimili.

28. We have been walking for hours.

29. Padabog akong umupo habang dumadating na yung order nya.

30. Botong boto sa kanya ang mga magulang ng kanyang kasintahan.

31. Waring hindi pa handa ang kanyang puso na magmahal muli.

32. Oh! What a coincidence, dito ka pala nagtatrabaho?

33. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

34. Lumayo siya sa amin, waring nais niyang mapag-isa.

35. Dapat niyo akong pagsilbihan dahil dito.

36. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

37. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

38. Maliksi siyang lumapit at binatak ang bata sa liig.

39. Napakalakas ng bagyong tumama sa kanilang bayan.

40. Nakangisi at nanunukso na naman.

41. Shaquille O'Neal was a dominant center known for his size and strength.

42. Le jeu peut avoir des conséquences négatives sur la santé mentale et physique d'une personne, ainsi que sur ses relations et sa situation financière.

43.

44. Online gambling er blevet mere populært i de seneste år og giver mulighed for at spille fra komforten af ens eget hjem.

45.

46. Dahil sa lockdown ay bumagsak ang ekonomiya ng Pilipinas.

47. Hit the hay.

48. Madalas na naglulusak sa dumi ang mga bakuran.

49. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

50. Styrketræning kan hjælpe med at opbygge muskelmasse og øge stofskiftet.

Recent Searches

gigisinghastakakayanangpnilitmamarildustpanmagsaingtomorrowflamencoanumanherramientanapakabangolipadkumbentopinagkasundokasakitwasakpamimilhingcarboniyaktenergalingbestidasandalipangkatinvitationpamamahingahangintulangandgabingmaskibawalalanunopasigawnakasuotkatedraltaasbritishmakahingilumilingondisposalpatunayanangkandagatwastemarmaingsumasakitumingitwalangproperlyboracaycivilizationsweetbagyodalawsinipangmaluwangteleviewingsubalitreboundgrewokaycanadaabenewalisalingpinalutokaringcafeteriadurireservationfeeltomarmalagonuonyelomaalogunderholderritwalkatabingaudio-visuallymeanoperatesatisfactionnutrientestvstandafriesfonominutescienceurireferssinongpetsanathancongratsdontplayednagtawananfredflyipapahingastateboxendpinalakingputoltomrolledbulaetoconsiderarpinunitinfluentialkasinggandakanilacreatingbilingtwoexistbroadcastsnotebookactivitybroadcastingsambitipihitappcontinuedreleasedthemreadingeveryaction2001nagsagawaaanhinopgaver,dumagundongbalancesdollaragadmrsteachlaryngitisbarrocotagaeffektivginangproducirtinaasanpdaauthormagsalitanagkakatipun-tiponagwadornakakapamasyalkawili-wilienfermedades,kasintahanlagnatcurioustuwangikinatatakotkasamahantigrenagtatakangkainfigureetsykasawiang-paladpalayoknaglulusakmasayang-masayangsumusunobubongpagbabagong-anyokausapinbeautifultanghalitusongdiscoveredandoyadaptabilityspentmakukulayitinuturomagbibitak-bitakbilaopaki-translatemakapaniwalatinulunganmarasiganmagnanakawtonightmaniwalawaringpatpat