Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

2. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

3. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

4. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

5. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

6. Marahil ay hindi mo muna dapat gamitin ang pera mo sa pagbili ng bagong gadget.

7. Kings may wield absolute or constitutional power depending on their country's system of government.

8. Nasa sala ang telebisyon namin.

9. Hindi maiiwasang magkaroon ng mga biktima sa digmaan, kasama na ang mga sibilyan.

10. Bakit anong nangyari nung wala kami?

11. Hindi ko alam kung paano ko sasabihin, pero crush kita.

12. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

13. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

14. From its early days as a technology for the elite, to its current status as a staple in most

15. A veces la realidad es dolorosa, pero no podemos escapar de ella.

16. Hun er utrolig smuk. (She is incredibly beautiful.)

17. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

18. Biasanya, bayi yang baru lahir akan diperiksa secara rutin oleh dokter atau bidan untuk memastikan kesehatannya.

19. Ano pa ho ang dapat kong gawin?

20. Marahil anila ay ito si Ranay.

21. No hay que buscarle cinco patas al gato.

22. Bakit ba nagkaroon ng landslide at baha?

23. Te agradezco por estar siempre ahí para mí.

24.

25. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong nakakaranas ng mga krisis at mga suliranin sa buhay.

26. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

27. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

28. Children's safety scissors have rounded tips to prevent accidental injuries.

29. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

30. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

31. Elektronisk udstyr kan hjælpe med at reducere energiforbrug og spare penge.

32. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

33. A lot of snow fell overnight, making the roads slippery.

34. Kanino mo pinaluto ang adobo?

35. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

36. Kumikinig ang kanyang katawan.

37. Sa kanyang huling araw sa opisina, nag-iwan siya ng liham ng pasasalamat sa kanyang mga kasamahan.

38. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

39. Eksport af teknologi er en stigende del af den danske eksport.

40. Ang sundalo ay nangahas na tumayo sa gitna ng labanan upang iligtas ang isang sugatang kasama.

41. The authorities were determined to find the culprit responsible for the environmental damage.

42. They are not singing a song.

43. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

44. Paki-drawing mo naman ako ng isang magandang larawan.

45. Andyan kana naman.

46. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

47. Working in a supportive and positive environment can improve job satisfaction.

48. Ayaw ng nanay kong magtrabaho sa Linggo.

49. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

50. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

Recent Searches

hastatsedeteriorategaindulaconductproudmagta-taxinapagodmamimissfuelpagsayadlittlesamakatwidipinikitestasyonkatipunanmemoryipanlinisoffentligenaninirahaniiwanpangyayarinakatirangiligtasginugunitaaraloperatecryptocurrency:silayagilitybestfriendaffiliateprincipalesjeepneypedemagkasamangpagsigawibinalitangsasagottraditionaldreamsikinalulungkotpagtatakapersonbarangaymayamantalagastudentsbumisitaganitokahitwonderlasmusicianpumuntaworkingevnemusicnilimasbilinfarlenguajemakatayoalleipinagdiriwangebidensyapaki-drawingworkmananaigsignificantpinakamahabarambutanquemasarapkargaelectronicpaki-translatekundikiniligtayotuvopowernapatulalamemoriahateenchantedroomtamadnapakamisteryosonagwo-worknaghandamejostudiedpoolmedikalkasintahanbowbalahiboqualitypologanangmag-uusapikinasasabikpagkababaisamacountlessboxingnakaraanhahatoltanghalipaki-basaideamarunongkayomasipagngingisi-ngisingpalapitsomethingpalasyoumuulannamumukod-tangioxygennagsidalomagbakasyonupuanhulihanmamihindidejaperyahanrubberspeechnakiramaytinawananmagulangrosasfremtidigemonumentobranchmotionmakenapagtuunannakapasahalamanhmmmmasayangpartnerknownalampananakopbabaeblogbanalpancitunapriesttradisyon10thnagreplynagtatanimsalamatnagkalatmasayapangkaraniwanandroidnabigkasnaniniwalasmokedurantelabaskorealender,cover,kirotkagalakandumagundongmataumanoespecializadasfriendkaysanag-oorasyonkenjipangilpinanoodextremistnapapahintonaglabananstyrernapagsilbihannagkakatipun-tiponmakakatalomagtiisdesarrollarondatatangopostpetsangoperasyon