Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. Ayoko magtrabaho sa bahay sapagkat naiinis ako sa buhok na ito.

2. Sa panahon ng digmaan, madalas masira ang imprastraktura at mga kabuhayan ng mga tao.

3. Kasi ho, maraming dapat kumpunihin sa bahay.

4. Naniniwala ka ba sa legend ng academy?

5. Ang pag-aaway ng magkasintahan ay hindi tama, at mas maganda ang pag-uusap para malutas ang mga problema.

6. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

7. Sa pagguhit, mahalaga ang pagpapakita ng depth at perspective sa mga larawan para maging realistic ang mga ito.

8. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

9. He is driving to work.

10. Salatin mo ang ibabaw ng mesa para makita kung may alikabok.

11. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

12. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

13. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

14. Mababa ang tubig sa ilog dahil sa tag-init.

15. Nagbigay ang albularyo ng anting-anting upang protektahan ang bata sa masasamang espiritu.

16. Pakipuntahan mo si Maria sa kusina.

17. Women have diverse experiences and backgrounds, including those based on race, ethnicity, and sexual orientation.

18. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

19. Mukha namang pangkaraniwan lang ang matanda at baka nga hindi pa nito alam kung paano humabi.

20. Uno de mis pasatiempos favoritos es leer novelas de misterio.

21. To infinity and beyond! at binaba ko ulit yung telepono.

22. Hindi mo na kailangan humanap ng iba.

23. The telephone has also had an impact on entertainment

24. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

25. Apa yang bisa saya bantu? - How can I help you?

26. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

27. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

28. Ailments can be a source of stress and emotional distress for individuals and their families.

29. Waaa. Ikaw pala salarin kaya ayaw nya sa ospital!

30. Ibibigay kita sa pulis.

31. The foundation's charitable efforts have improved the lives of many underprivileged children.

32. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

33. Pwede ba kitang tulungan?

34. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

35. Ang pagiging maramot ay salungat sa pagiging bukas-palad.

36. Limitations can be financial, such as a lack of resources to pursue education or travel.

37. Nang malaman ko ang kasinungalingan ng aking kaibigan, nagpalabas ako ng malalim na himutok sa aking sarili.

38. Ilang kilo ng pinya ang binili niya?

39. El puntillismo es una técnica de pintura que utiliza pequeños puntos de color para crear la imagen final.

40. La physique est une branche importante de la science.

41. Mahirap magsalita nang diretsahan, pero ito na - crush kita.

42. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

43. Tesla's Gigafactories, such as the Gigafactory in Nevada, are massive production facilities dedicated to manufacturing electric vehicle components and batteries.

44. Ang tag-ulan ay isa sa mga panahon ng taon na nagdadala ng malakas na pag-ulan at kadalasang nagdudulot ng baha at landslides.

45. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

46. Aquaman has superhuman strength and the ability to communicate with marine life.

47. The acquired assets included a portfolio of real estate properties.

48. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

49. Presley's influence on American culture is undeniable

50. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

Recent Searches

hastangayobadjackynagtungohagdangumisingturismogitnawishingmaliksinanonoodnakarinigbenefitsmuntingmayovigtigsteexplainbentangmahigitrecentmilaantonioditoklasehumigaricolaylaypatuyohawaiisiyangkalyenagpakunotmasaganangwednesdaywaterkusineropinagmamalakirosarioefficientdesarrollaronwebsitesandwichjuegospagpapakalatnilanginfusionesalangantonopinabayaanlibagsinanagliliwanagantokpebreropinilitriskfacultyoverviewrequierensandalirebolusyonlaptophundredpinagtabuyannanamanpaghalakhaknuevoginawangrenacentistalumindolpulispagkalungkotpangitgataskassingulangkangitannangangahoycapitalistavailablestrategyinferioreskumbentobiyashearmaestraiba-ibangdesdesumayawerenagpaalamsulokdireksyonsiopaopootnapakamotnanlilimosambagmadulasjoemagsaingnawalaexistmaligayainilistabintanadalawangpaslitginagawaofficeipapainitawitanpalakaneromasayang-masayasinumangrightsnalagutansimulasalarinpabulongsakalingspentbutihingdiagnostictotoonggenerationsamendmentsalignslarawanpataysaktancovidpalaymulgalitmensmasasalubongbestbiniliadditionally,ipagamothouseholdmananakawlegacymakawalamakikitulogkalayaancultivokatuwaanmarketingnapatigildadalawinpangyayaripublicationatepointsagotiniskapetvsfitpulang-pularevolutionizedbroadcaststelecomunicacionesnakapasatrainingunospagsidlanfiarimasbobosang-ayonsumakitakojuniotrabahoaaisshnagsuotatensyontumahandipangstonehamtumalimbuenapanalanginpartnerkayokarangalanmabibingitirangspiritualproductividadinsidentetinulak-tulakbutchnagsmilelaranganlumibot