Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "hasta"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

3. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

4. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

5. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

6. Tendremos que tener paciencia hasta que llegue nuestro turno.

Random Sentences

1. Hinila niya ako papalapit sa kanya.

2. Tulad ng dapat asahan, bumuhos na ang malakas na ulan.

3. Sa soccer, sinipa ni Andres ang bola papasok sa goal.

4. Salamat sa alok pero kumain na ako.

5. Hindi mo na kailangan mag-isa dahil ako ang iyong kaulayaw.

6. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

7. Emphasis can be used to provide clarity and direction in writing.

8. Naging bahagi siya ng agaw-buhay na rescue mission upang iligtas ang mga tao sa panganib.

9. Ang paggamit ng mga aromang nakakarelaks tulad ng lavender ay nagbibigay sa akin ng isang matiwasay na tulog.

10. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

11. Elektroniske apparater kan hjælpe med at overvåge og forbedre kvaliteten af ​​produkter.

12. Habang nglalaba si Aling Rosa at iba pang may-bahay ay masayang nalalaro at naliligo ang mga bata.

13. Kinabukasan ay nawala si Bereti.

14. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

15. Para cosechar las almendras, primero se deben sacudir los árboles con cuidado.

16. Hendes skønhed er betagende. (Her beauty is mesmerizing.)

17. Protecting the environment involves preserving natural resources and reducing waste.

18. They have been studying science for months.

19. There are a lot of reasons why I love living in this city.

20. May konsyerto sa plasa mamayang gabi.

21. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

22. Dapat bigyang pansin ang kawalan ng seguridad sa trabaho ng mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

23. Laging pinapasaya ni Nicolas si Helena kaya tuwang tuwa ang mga magulang nito sa kanya, itinuring na siyang kapamilya ng mga ito

24. Ang kamalayan sa epekto ng teknolohiya sa lipunan ay nagbubukas ng mga pinto sa masusing pagsusuri.

25. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

26. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

27. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

28. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

29. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

30. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

31. Las hojas de lechuga son una buena opción para una ensalada fresca.

32. El arte abstracto se centra en las formas, líneas y colores en lugar de representar objetos reales.

33. Malamig sa Estados Unidos kung taglagas.

34. Mababa ang tubig sa ilog dahil sa tag-init.

35. Hindi ko kinuha ang inyong pitaka.

36. Bagamat naghihirap ay alaga siya ng ama't ina sa masasarap na pagkain.

37. Sa hatinggabi, naiiba ang itsura ng mga lugar kaysa sa araw.

38. Dogs can provide a sense of security and protection to their owners.

39. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

40. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

41. Gusto mo bang sumama.

42. Retweeting is a feature that allows users to share others' tweets with their own followers.

43. Lahat sila ay angkan ng matatalino.

44. Tobacco was first discovered in America

45. Nasa loob ng bag ang susi ko.

46. Mahalagang alamin ang interes na ipinapataw ng utang upang malaman kung magkano ang babayaran na kabuuang halaga.

47. Nanghiram ako ng bicycle para sa isang bike race.

48. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

49. Panahon ng pananakop ng mga Kastila

50. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

Recent Searches

sinungalingimbeshastareynatinapaybiyasdreamstamadpaligidarghrimasnasabingpulubicapitalpalapitonlinemorenanapatingalablusangbevarehiningiadoptednicohmmmmvelstandpatibingopaboritofollowedexamsystematisksuffermedidabakitlordhearsilbingtonightbangcareleoprinceelviscanadaradiofurtaingacreationmuchashumanostenlarrynaminggranfridayroonbillsumakitmatchingbugtongzoompinalutohydelbasahanngayonguhitgeneratedaratingsarilinglastingpracticadodaigdigconectanlibrestonehamtekstoperatedrewknowsshowfatnakapanghihinaprovedevelopedclassesgeneratedbeyondnotebookclienteprotestaniceaggressionpeteranimcakeipapahingabaldemind:planchefdancecosechakapitbahaypaghaliknakapapasongsportspagsidlanhealthierreserbasyonkamisetang1876nagkakasyanakasakithinugotsikipnapahintoartistanagmamadalitokyolihimi-rechargeinulitkahilinganmalumbaynangtradetsaaliligawanaregladobarlinekamaymedpakealameeeehhhhkumalmaexpertnakakabangonhitikboyfriendsystems-diesel-runkalaunankinahuhumalinganbihirangmagsusunurannoongsumayawsisipaindoble-karatinangkapartnerkasiyahansometumahimiknakasilongreadpundidonamuhayiatfsimuleringermakitalungsodcampaignsmaghilamoskamukhabigasmagkasintahanpamburamakikitaadvertising,walkie-talkieordertungawerlindakinakaliglignasasabihanfotosbiologipagmamanehosaritanaiyakpagkakamalinanahimikpagpapasandisfrutarmagbantayadgangnapasigawinaamintemparaturaunattendedmagdoorbelltutungomedikalnanlakiihahatidmakuhangyespagsagotbowl