Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "reservation"

1. Ilang araw ang reservation natin sa hotel?

Random Sentences

1. Las plantas ornamentales se cultivan por su belleza y se utilizan para decorar jardines y espacios interiores.

2. Les personnes âgées peuvent avoir des relations affectives et intimes avec leur partenaire.

3. Masarap ang bawal.

4. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

5. Ano ang gagamitin mong hiwa ng baka?

6. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

7. Nagtatanim ako ng mga gulay sa aking maliit na taniman.

8. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

9. Humingi ng paumanhin ang inang makakalimutin subalit nagsiklab sa galit ang anak na sutil.

10. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

11. Seryoso? Ngayon ka lang nakakaen sa fastfood? tanong ko.

12. Ang sakit niya ang nakapanghihina sa kanya.

13. Kayo din po ba ang nagpapakain sa kanya?

14. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

15. The wedding reception is a celebration that usually follows the wedding ceremony.

16. Maraming taon na ang nakaraan, may isang munting baranggay sa paanan ng isang bundok.

17. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

18. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

19. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

20. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

21. Magkano ang halaga ng bawat isang blusa?

22. Elektroniske apparater kan hjælpe med at forbedre præcision og nøjagtighed af forskellige opgaver.

23. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

24. Sumasakit na naman ang aking ngipin.

25. In conclusion, the telephone is one of the most important inventions in human history

26. Bago siya ipinatay, si Rizal ay isang aktibistang politikal na lumaban sa korupsiyon at pang-aabuso ng mga Espanyol sa Pilipinas.

27. He has become a successful entrepreneur.

28. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

29. Hindi siya makabangon at makagawa ng gawaing bahay.

30. Huh? Paanong it's complicated?

31. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

32. I am enjoying the beautiful weather.

33. Helte kan være en kilde til inspiration og motivation.

34. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

35. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

36. Saan niyo ho ba iniisip bumili ng bahay?

37. Ano ang nasa tapat ng ospital?

38. Kung kaagaw ko ang lahat, may pag-asa bang makilala ka?

39. Users can create and customize their profile on Twitter, including a profile picture and bio.

40. Paano ako pupunta sa Intramuros?

41. A picture is worth 1000 words

42. Tatlong araw na po akong hindi kumakain at palabuy-laboy dahil sa wala po akong tirahan, ang pagsumamo ng bata.

43. Nagtatrabaho ako sa Mimosa Family Home.

44. Put all your eggs in one basket

45. Binabaan nanaman ako ng telepono!

46. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

47. Ngumiti ako saka humalik sa mga labi niya.

48. Es importante reconocer los derechos y la dignidad de todas las personas, incluidas las personas pobres.

49. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

50. Have they visited Paris before?

Recent Searches

transmitsreservationligayanakakagalingikukumparapansolbilaomakagawaibaliktumatanglawetodulotplatformdontactionpinalutowhygenerabasandalingcultivoentrancenakatuwaangcommissiondyosanakapangasawamalawakpaskonghistoryrichkumikilosopportunitiesaffiliategumigitikadalagahangjeepneyhayaanlumindolwaride-lataalinpinasalamatanulammarasiganinterestsstaykilongnalalabirosatumawacocktailnagsagawabulalasanagamotoliviayelomaingatpalakapasokhulipisngikumbinsihinnagbiyayakasilibertyugatt-shirtkunebilinnamataysong-writingpusonilayuantalinoibotonakahainsunud-sunurannangyayarihinabidecreasenagitlapabalingatseenreturnedarkilajobslagaslasmawawalawalngnaramdamanlumbaynaminmayabongumingitjulietcantidadbisiggagamitinevennakapuntanyeranaynapakahusaylansangan1954magbagong-anyosulatarabianagtagisannatanggappetsapalayannakaririmarimsumusunolingidnumerosasandytwinklepangingimilarangankahitlalargapagsayadagam-agamgayunpamanpaulit-ulitmagingcarbonkasinggandalumungkotlarongisubomultomahigpiterapfreedomsskypemapsaranggolanapakabilissambitalituntuninmakakakainpangkatdingginmagsunogoutlinememojamesnamingdincnicoestasyonkatulongmissionnaka-smirkhayaangsinabiaumentarphysicalbiluganglikodconsistrepublicanlettermovienakaluhodnangyaribakitkinauupuangsongsasinnakangisilinggongbumabalottatawagniyanbecamebumotoafterkasalukuyanlalobukasremainexigentetinuturobakaimportantesmarangyangkantoindennalakimatagumpaylayuannaputolnaabutansamantalangpahaboldiinarbejder