Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "area"

1. Another area of technological advancement that has had a major impact on society is transportation

2. The police were searching for the culprit behind the rash of robberies in the area.

3. The United States is the third-largest country in the world by land area and the third most populous country in the world.

Random Sentences

1. Las serpientes hibernan durante los meses más fríos del año, reduciendo su actividad metabólica y buscando refugio en lugares protegidos.

2. Ang mailap na impormasyon ay kailangan pag-aralan ng mabuti upang maiwasan ang pagkakamali.

3. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

4. Utak biya ang tawag sa mahina ang pag iisip

5. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

6. Kumain ako ng sinigang sa restawran.

7. Helte kan være en kilde til inspiration og motivation.

8. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

9. Maliit lang ang kusina ni Lola Oliva.

10. The early bird catches the worm.

11. Wala nang gatas si Boy.

12. Ano ang nasa bag ni Cynthia?

13. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

14. Den danske kirke fejrer påsken med flere forskellige ceremonier i løbet af Holy Week.

15. Malilimutin siya sa mga pangalan ng tao kaya’t lagi siyang nahihiya sa pakikisalamuha.

16. Limitations can be physical, mental, emotional, financial, or social.

17. Making large purchases without consulting your budget is a risky move.

18. Ang aso ay tumakbong palayo nang makita ang estranghero.

19. Hiramin mo ang aking payong dahil umuulan ng malakas.

20. At ignorere sin samvittighed kan føre til skyldfølelse og fortrydelse.

21. Hindi kita puwedeng iwan dahil mahal kita.

22. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

23. Microscopes have played a critical role in the development of modern medicine and scientific research.

24. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

25. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

26. Nakahug lang siya sa akin, I can feel him..

27. Sa kasalukuyan, yumabong ang interes ng mga tao sa pagsasaka ng mga organic na gulay.

28. Ok na sana eh. Tinawanan pa ako.

29. ¿Cual es tu pasatiempo?

30. Aller Anfang ist schwer.

31. Medarbejdere skal ofte undergå årlig evaluering af deres præstation.

32. Bagaimanakah kabarmu hari ini? (How are you today?)

33. Ayaw sumindi ng ilaw. Pundido na yata.

34. Ikinagagalak ng pamahalaan na maghatid ng tulong sa mga nangangailangan.

35. Maari mo ba akong iguhit?

36. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

37. Cuando las plantas tienen al menos dos hojas, trasplántalas al lugar definitivo

38. Bakit niya gustong magpahaba ng buhok?

39. Tila hindi niya gusto ang mga sinabi mo.

40. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

41. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

42.

43. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

44. I am absolutely confident in my ability to succeed.

45. Nag-aaral siya sa Seasite bawat araw.

46. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

47. Balak kong magluto ng kare-kare.

48.

49. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

50. Sino ang puwede sa Lunes ng gabi?

Similar Words

areas

Recent Searches

areajailhouseuuwiinspirasyoniconnapaagalegendsdiliwariwnageenglishkulunganbingbingkararatingtengaperyahanipapautangnakakaenhigaanmalalakiperanglalawiganhiwanakipagkabibiailmentsofficenakakatabakababalaghangtandangpauwibulakalaktanodsabaybatok---kaylamigsangkalanmagtakagoshmakisuyokaagadnabigaynecesariomedikalneed,utusansinapokgripobumugakagandatumingininspiredalamidtilamaagamagbayadmataomagsugaltaladilaasongnapakalamiginnovationnaglalatangmalamankasamahannakaratingwalkie-talkiemasungitcrazynatuloymasamangkokakalaskapeteryasiyapagsusulatna-suwaypakpakmilyonggalaanmunanghinagud-hagodairplanesbalikmag-iikasiyamearlypawiinhalakhakbiyahevibratepatalikodvalleyproductionitanongde-latalalakimejonaglipanapalagayfatmangiyak-ngiyakatingpaglulutobolasinoprosesomakawalanararamdamanbotongkangkongkriskasusundosinampalsetssmilelibanganwhetherpangkaraniwangpassivecadenaatagiliranmarkedsekonomitaon-taonpaakyatibibigayparinginabotmadilimkabilismanalopagtuturohacerlednagre-reviewpromotingdioxidenapakaramingsumabogcreatednapaghatianenchantedkinakawitanhubadscottishmagaling-galingmagkakasamalasinggeroobservererinsteadwhygustinglumutangmagpapapagodpangkaraniwanrangemahalinlihimmakakainconsideritimcommercefall3hrstangkapagigingehehesistemasnicebugbuginpaderkakainpinagtabuyanpintuanarguetiketmaintindihancompletingpaki-basaejecutarcomolugawcommunityutilizarpramistakekapangyarihanbagkus,kumirotwatawatawaresourcepracticescreatingartificialkubyertoshomeworkhierbasipabibilanggocontrolabagyongmetodedumiretso