Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "area"

1. Another area of technological advancement that has had a major impact on society is transportation

2. The police were searching for the culprit behind the rash of robberies in the area.

3. The United States is the third-largest country in the world by land area and the third most populous country in the world.

Random Sentences

1. The doctor prescribed antibiotics to treat the pneumonia.

2. Nagpapantal ka pag nakainom remember?

3. Les personnes endettées peuvent se retrouver dans une situation financière difficile.

4. L'entourage et le soutien des proches peuvent également être une source de motivation.

5. Les enseignants jouent un rôle important dans la réussite des étudiants.

6. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

7. Medarbejdere kan arbejde i forskellige miljøer som kontorer eller fabrikker.

8. Dala ng malakas na pagdidilim, mas lalong nahirapan akong makita ang daan pabalik sa tahanan.

9. Kumikinig ang kanyang ulo at nangangalit ang kanyang ngipin.

10. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

11. Maganda ang pakiramdam kapag mayroon kang kaulayaw na makakasama sa buhay.

12. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

13. Aller Anfang ist schwer.

14. Nabangga ang kotse ni Juan bandang alas-tress ng hapon.

15. La labradora de mi vecina siempre ladra cuando alguien pasa por la calle.

16. Me gusta mucho dibujar y pintar como pasatiempo.

17. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

18. No puedo imaginar mi vida sin mis amigos, son una parte muy importante de ella.

19. They are attending a meeting.

20. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

21. The feeling of baby fever can be both exciting and frustrating, as individuals may face challenges in fulfilling their desire for a child, such as infertility or other life circumstances.

22. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

23. Elektroniske apparater kan hjælpe med at forbedre kommunikation og forbindelse med andre mennesker.

24. Dumating siya sa tindahan ng mga tuyong paninda at bumili ng isang kartong mantika.

25. Better safe than sorry.

26. They are building a sandcastle on the beach.

27. Hindi dapat natin ipagkait sa mga kabataan ang agaw-buhay na pagkakataon sa edukasyon.

28. Agaw eksena ang babaeng himihiyaw sa palengke.

29. Buenos días amiga

30. Wala kang pakelam! O sige its my turn na!

31. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

32. Morgenstund hat Gold im Mund.

33. Eine hohe Inflation kann zu einem Anstieg der Sozialausgaben führen.

34. Folk med en historie af afhængighed eller mentale sundhedsproblemer kan være mere tilbøjelige til at udvikle en gamblingafhængighed.

35. Hindi na siya pumasok para maabutan lang ang dalaga, ngunit, sa kasamaang palad hindi niya ito inabutan.

36. Bakit siya ginaganoon ni Ogor?

37. Si Marian ay isang sikat na artista sa Pilipinas.

38. Sa sobrang lamig ng tubig, hindi ko magawang salatin ito nang matagal.

39. Miss, nakalabas na ba yung pasiyente dito?

40. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

41. Nagmumukha siyang Intsik-beho kapag suot iyon ngunit wala naman siyang maraming kamisetang maisusuot.

42. At naroon na naman marahil si Ogor.

43. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

44. Ano ang gustong palitan ng Monsignor?

45. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

46. Her decision to sponsor a child’s education was seen as a charitable act.

47. The symptoms of pneumonia include cough, fever, and shortness of breath.

48. Ang panaghoy ng mga pasyente ay naging panawagan para sa mas maayos na serbisyong pangkalusugan.

49. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

50. The library has a variety of books to choose from, ranging from classics to modern literature.

Similar Words

areas

Recent Searches

populationareanakaupobilihinmethodsshiftextramahihirapinaapieditmemorycircleconsidercreatingmiyerkolesk-dramaniyangusting-gustokatutubonakakapamasyalmagpapakabaitmanatilinaglutomalapalasyonagtagponapadpaddesarrollaronpag-uugalibiglaanmagalangalintuntuninbestidabulaknasasabingspeechnamungahandaaniconstinioteknolohiyasidoprinsipesernatigilantigilexpertgabingmagpapabunotkaliwabagsakinvitationsampungcommunitykaharianitinalagangvitaminnagliliyabkatawannababalotrisknaritomassachusettsgiftpandemyanagmahinanghinamaklamesamalilimutanrevolutionizedsalaminmagpapabakunadisciplinexperience,ganyanminahannapakamalayanpesossiguroherramientasmaghapongmatulunginautomationwasakpasensyakontingwidelymasipagvivainimbitainiintaysumingitsinakopfullnaming10thjaceformasresearchaalisbabaeboksingklimamalagodagaoliviatag-ulan1935pangalankauntigovernmentsundalokinalilibingankayabanganpawiinnaapektuhanpumitasnagkasakitmahahaliktanggalinkusineroindustriyamakilalamagtiwalamatumalpropesorlumusobtinuturovedvarendemakapaltuktoknakabibingingvidenskabnauliniganikukumparasagingkalaunanbusinessessinasadyasiniyasatmagsi-skiingpanghihiyanginilalabasnagpuyospartiesmahiwagangeconomypagsumamonananaghilimonsignorkatawanghila-agawanpapagalitannagbakasyonnagmamaktoltravelerkasalukuyanjustkomunikasyonlaki-lakimagpa-ospitalpagpapakalatikinagagalakmarasigannanalokuwentosinusuklalyanilalagaynanunurilumibotvideospinigilannagdadasalkumantaeroplanotsinapagsusulitsunud-sunodexigentenaglulusaknakabaonmakisuyomanakbobusiness:ibabawsaidthroatamericanmaliitparoroonalalongtulalaalmacenarpalibhasahinabolmabutisumasaliwcameraindia