Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "parating"

1. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

Random Sentences

1. La mer Méditerranée est magnifique.

2. Sa gitna ng galit at poot, nahihirapan akong makapagpatuloy sa aking buhay.

3. Today, Bruce Lee's legacy continues to be felt around the world

4. Wala ka na bang iba pang gustong puntahan?

5. Ang sugal ay isang laro ng pagkakataon na kadalasang nagbubunga ng pagkatalo kaysa panalo.

6. Magpapabakuna ako bukas.

7. The Incredible Hulk is a scientist who transforms into a raging green monster when he gets angry.

8. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

9. Eh what's the big deal ba? Parang kasama lang kahapon eh.

10. Si Ana ay marunong mag-dribble ng bola nang mabilis.

11. Da Vinci fue un artista renacentista muy importante.

12. Kailangan ko ng Internet connection.

13. Me gusta mucho dibujar y pintar como pasatiempo.

14. Hindi ito nasasaktan.

15. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

16. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

17. Ako ay nagtatanim ng mga puno ng niyog sa aming lupang sakahan.

18. The acquired assets will be a valuable addition to the company's portfolio.

19. Oo. Gusto ko na lang sana talaga makauwi. sagot ko.

20. Oh, kinaiinisan mo pala? Eh bakit naging paborito mo?

21. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

22. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

23. The surface of the hockey rink is made of ice, which can be slippery and challenging to navigate.

24. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

25. Di na natuto.

26. Hindi na natapos ang aming hiking dahil sa biglang pagdidilim ng kalangitan.

27. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

28. Nagtapos sya sa unibersidad ng Pilipinas.

29. He is typing on his computer.

30. Sumigaw ng malakas si Perla "Paro! Paro!", marami ang nakarinig at tinulungan siya ngunit walang Amparo silang nakita.

31. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

32. Naku, ang taas pala ng temparatura ko.

33. Ilan ang mga puno sa bakuran ninyo?

34. Paano po pumunta sa Greenhills branch?

35. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

36. Doon nyo sabihin ang gusto nyong sabihin at doon nyo gawin ang gusto nyong gawin

37. Es importante ser conscientes de nuestras acciones y cómo pueden afectar a los demás.

38. Has he spoken with the client yet?

39. La santé sexuelle est également un élément important de la santé globale d'une personne.

40. Keep in mind that making money online takes time, effort, and patience

41. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

42. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

43. Las plantas ornamentales se cultivan por su belleza y se utilizan para decorar jardines y espacios interiores.

44. I accidentally spilled the beans about the surprise trip, but she was still excited.

45. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

46. Smoking cessation can have positive impacts on the environment, as cigarette butts and packaging contribute to litter and environmental pollution.

47. Ang tagtuyot ay nagdulot ng krisis sa agrikultura sa buong rehiyon.

48. Sí, claro, puedo esperar unos minutos más.

49. I have been working on this project for a week.

50. The package's hefty weight required additional postage for shipping.

Similar Words

Iparating

Recent Searches

paratingauthornaiinggitcandidateevenputipdarestheitrackbridechambers4thhatemonitorulingvisuallearnrefactivitygoingpracticescreatingslavepowersprotestauponfacultypagpapakalatnag-uumigtingnag-asaranpulang-puladistancesmakakakaenkusinerobusydraft:apppesoagadpinagsanglaanleadpatuloyanakdaliproductividadpagapangtumahankurakottumalimcompletamenteinspirasyonkasaysayanbumagsakangkanpagbatisalamangkeronagyayangmaestramabibingikayomaglaroinfusionesinfluencesgrammarphonenewcitizenteachmediantelaylayvedmabutingmainstreambaku-bakongnakatulogmakalipascoursespinaghatidansupportmagkaibangnagpepekesakristanmanghikayatpagdukwangminu-minutomahahanaynapapasayaallowsmoneyrolepinagpatuloymakikipaglaronagpakitabangladeshmagkahawaknakakapamasyalkalalakihantinulak-tulakdatingmaglinistitakagabinakakagalapinakabatangnakatiranagkwentonanghihinatravelernagtungonakapagsabinakatayokuwentomatabangaplicacionespangangatawanphilanthropykalalaromaipagmamalakingbagsakdeliciosacruzpagtutollawakontratatabingpuntahannangangakonapatulalamananalonakahuglalakadmanatilionline,nagbentatinungocountryiiwasannahahalinhanre-reviewmagagamitpaidaabotminervieiniresetabinitiwansiopaowriting,pinangaralannanamanseryosongkesobiglaansahodroofstocknapadpadpagongasukalnaantigsakensisipainkabarkadakutsilyopagkaingdalawangahhhhganyanwondermalasutlahunikasakitproudbestidadeletingtrajebooksdiapermaisipipinamiliphilippinestopasigawiyansagapiconselectorallistahanwaterabangannasabingmayrooneffektivkwebamangingisdasigasnatwo-partycassandraiconicnakasimangot