Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "i-recharge"

1. Halika, i-recharge natin ang baterya mo.

2. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

Random Sentences

1. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

2. Las redes sociales son una plataforma para compartir fotos y videos.

3. The detectives were investigating the crime scene to identify the culprit.

4. Itinapon nito agad ang nasabing bunga pagkatikim dahil sa sobrang asim.

5. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

6. Landet er en af de mest velstående i verden, og dette kan tilskrives en række faktorer, herunder en høj grad af økonomisk vækst, en velfungerende arbejdsstyrke og en høj grad af offentlig velfærd

7. Puwede akong tumulong kay Mario.

8. Su obra también incluye frescos en la Biblioteca Laurenciana en Florencia.

9. Ang daming limatik sa bundok na kanilang inakyat.

10. Walang makakibo sa mga agwador.

11. Ano ang kinakain niya sa tanghalian?

12. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

13. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

14. Napatingin ako sa kanya bigla, Kenji?

15. Les préparatifs du mariage sont en cours.

16. Sila ang unang angkan ng mga aso sa daigdig.

17. Different? Ako? Hindi po ako martian.

18. Umalis siya kamakalawa ng umaga.

19. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

20. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

21. Ano ang ginawa ni Trina noong Pebrero?

22. Les personnes âgées peuvent bénéficier d'un régime alimentaire équilibré pour maintenir leur santé.

23. Emphasis is often used in advertising and marketing to draw attention to products or services.

24. Make a long story short

25. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

26. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

27. Naramdam ng pagkaawa si Mang Kandoy kaya't agad niyang binato ng isang piraso ng matigas na kahoy ang tigre upang malihis ang atensyon nito sa usa.

28. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

29. Mathematical formulas and equations are used to express relationships and patterns.

30. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

31. Pakibigay ng respeto sa mga matatanda dahil sila ang unang nagtaguyod ng ating komunidad.

32. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

33. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

34. Ang pag-asa ay nagbibigay ng pagkakaisa sa mga tao sa kanilang pangarap at mga layunin sa buhay.

35. Nagpunta si Emilio Aguinaldo sa Hong Kong pagkatapos ng Biak-na-Bato.

36. Maaf, saya terlambat. - Sorry, I'm late.

37. Ang pag-alala sa mga bayani ay isa sa mga paraan upang maipakita ang pagpapahalaga sa kanilang sakripisyo at pagmamahal sa bayan.

38. The package's hefty weight required additional postage for shipping.

39. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

40. Before a performance, actors often say "break a leg" to each other for good luck.

41. Magsusuot ako ng Barong Tagalog.

42. Hindi ko sinasang-ayunan ang kanilang ideya kaya ako ay tumututol.

43. Ang buhawi ay maaaring magdulot ng pagkalbo sa mga puno, pagbagsak ng mga poste ng kuryente, at iba pang pinsala sa imprastruktura.

44. Nakikihukay siya ng mga halamang ugat at namumulot ng tirang pagkain.

45. Sa ganang iyo, dapat bang palawigin pa ang curfew hours sa ating lungsod?

46. She was born on June 26, 1993, in Boca Raton, Florida, USA.

47. Oo, kinanta 'to sakin ng isang babaeng kinaiinisan ko...

48. Emphasis is an important tool in public speaking and effective communication.

49. The Getty Center and the Los Angeles County Museum of Art (LACMA) are renowned art institutions in the city.

50. The beach has a variety of water sports available, from surfing to kayaking.

Recent Searches

i-rechargenai-dialnakatuonmagdaraosnagwo-workpagkaawatumikimkainitantrentasinosinisirananangisgelaidescargarpinalambotmaghapongmahahawapagpalitnabasakambingbutasindependentlybarangaylalimlabahindefinitivokasaysayanlaruanothersgymmonumentokinatatakutanplasakasingtigasmanghuliinihandabalotkumatokrabeinsteaddreamclientssentencemustgrinserannuonmatchingandbarnescryptocurrency:elitefuebagkus,naisbulsalackthendolyarheypinilinghimselfplatformseksameyefacilitatingngingisi-ngisingevolvetopicfourmulinghimigqualitytasaideyadaddybagsakdahan-dahannakatayonapakakamaykayailannakatirakasamainfluentialhinaboleskwelahankapagpayoopotrinaisaacfriendproyektoagilakuwebanagbasanapakalusogmagkakaroonsalarinyelonagtalagalungkottinitignannagbabalanegosyoinspirehumihinginangahasmakakatakasikinasasabiknakapagngangalitnagsisigawnagawangobra-maestranagwelganabalitaanpag-aaralisipre-reviewjejumaliwanagnag-uwimanahimikmagsisimulahistorynasagutanmaghahabitumamisginawangreorganizingnapilitinatanongtaosautomaticbanalbarcelonatiniklingkumantanaghubadgennatanawcaraballonuevoisinamafollowedbulongmachinesaregladokamotekinalimutantshirthverreguleringstockslumilingondyipnikenjicolororganizebuntisinalagaanpinaladvehiclestoothbrushadangchangepedeuncheckedsinabichavitpumitaspaglapastanganteachnagitlacigaretteleddoneexpectationsregularmenteraw1982stylesevolvedcreatinginternaladasetkeepingcharitablepaumanhinsaritademocraticincreasesbilanggonatandaanlumisantaonaulinigan