Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "tools,"

1. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

2. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

3. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

4. Kailangan ko ng pliers, puwede ko bang hiramin ang iyong tools?

5. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

6. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

7. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

8. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

9. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

10. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Random Sentences

1. He has been meditating for hours.

2. Les étudiants sont encouragés à poursuivre des activités de bénévolat pour développer leurs compétences en leadership.

3. Magkasingganda ang rosas at ang orkidyas.

4. Limitations can be challenging, but they can also inspire creativity and innovation.

5. Nationalism is often associated with symbols such as flags, anthems, and monuments.

6. Regular exercise and playtime are important for a dog's physical and mental well-being.

7. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

8. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

9. Ano ang ginawa mo para sa selebrasyon nyo?

10. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

11. Ganun? ok. disappointed na sabi ko.

12. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

13. Emphasis can be used to persuade and influence others.

14. The package's hefty weight required additional postage for shipping.

15. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

16. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

17. This can be a great way to leverage your skills and turn your passion into a full-time income

18. Kahit mahirap ang buhay noon, nagsumikap si Carlos Yulo upang maabot ang kanyang mga pangarap.

19. And dami ko na naman lalabhan.

20. Saya sayang dengan keindahan alam di Indonesia. (I love the natural beauty of Indonesia.)

21. Palibhasa ay karaniwan nang nakakamit ang kanyang mga layunin dahil sa kanyang determinasyon at tiyaga.

22. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

23. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

24. Kebebasan beragama dijamin oleh konstitusi Indonesia dan dihormati dalam kehidupan sehari-hari.

25. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

26. Gusto kong hiramin ang iyong cellphone para tawagan ang aking kaibigan.

27. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

28. Joshua, kumusta ang pakiramdam mo?

29. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

30. Nang sumapit ang ika-12 ng hating gabi, nagpalit ng anyo ang kakaibang pusa.

31. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

32. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

33. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

34. I have seen that movie before.

35. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

36. El nacimiento de un bebé es un recordatorio de la belleza de la vida.

37. Ikaw ang dumukot ng pitaka ko, ano? Huwag kang magkakaila!

38. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

39. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

40. Ang malakas na pagkokak ng mga Palaka at paghuni ng mga Kuliglig ay sumaliw sa awit ng mga Maya.

41. Tahimik ang buong baryo sa takipsilim.

42. Meskipun mayoritas Muslim, Indonesia juga memiliki komunitas yang kuat dari agama-agama lain yang berkontribusi pada keragaman budaya dan sosial.

43. Ils ont déménagé dans une nouvelle maison récemment.

44. Isang kakaibang ritwal ang nakita nila sa kagubatan kung saan nagsayaw ang mga tao sa ilalim ng buwan.

45. Practice makes perfect.

46. Tiyak na may isda kang mahuhuli! Sige, layas! Layas! pinagtulakan ni Kablan ang kaawa-awang matanda na napasubsob sa tarangkahan ng malaking bahay.

47. They clean the house on weekends.

48. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

49. Nanood sina Pedro ng sine kahapon.

50. Si Hidilyn Diaz ay nagtayo ng weightlifting gym upang suportahan ang mga susunod na henerasyon ng atletang Pilipino.

Recent Searches

asinpingganamongtools,sparkfurywatchingtryghedwowabimatindingzoomboyetotraspshcommissionverytonsystematiskcriticsmisakauna-unahangpointninyongskillsmallandydraft,goinginvolveserviceselectedreaddingdingdeclarestatinghapdirepresentedreleasedimpactedimprovedrawapollobeforegenerationstalebowsteerarmedsafefullanimmagbubungadarkcheckscakeresourcesnasundoyonenddoondividescrossbehalfbinabaupworkeasydollardinggindinalababaspeechbringnakatirangprogramaprogressefficientcomplexwhileexamplekapilingprogrammingknowledgeprocessmakapilingstartedeffectmapgeneratedbatahateexistcurrentworkshopgitnapublishedyeahsettingformatdependingbackduloconvertingstyrerentryclientemitigateinfinitygapadaptabilityinteractinterviewingmanagerlearnseparationtermawareamountryancharitableipinalutoheftydedicationbenbumigaybagamatpaalamngunithalinglingreferslondonblusamauntogkumitagirlpagtutolsocialesinabutandistanciaamericatatanggapinmarketingnatigilanma-buhaypanindangviolencemaglutovelstandredigeringingatanagosbetatwopaligsahanmakawalastringinatakepananimmeetmakakawawaumangatsunud-sunuranpyschekatagangadmiredfacemaskmakalipasmakasarilingrenatoself-defensevistparinkabibibumahacomesatisfactiongoodfloorpagdukwangmensajesmagpagalingnagkwentoaanhintatlumpungpinahalatanamumulotpaglalabadaturismonakalilipaseskuwelapinapasayanagkakasyapaglalaitnahawakanmagkaparehokinauupuangmagsusunurancultivanakatuwaangbloggers,