Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "tools,"

1. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

2. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

3. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

4. Kailangan ko ng pliers, puwede ko bang hiramin ang iyong tools?

5. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

6. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

7. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

8. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

9. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

10. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Random Sentences

1. Pagkatapos, dapat mong i-mark ang mga lugar kung saan mo gustong magtanim ng mais at mag-plant ng mga buto sa mga ito

2. Naghingi ako ng pahintulot na hiramin ang kotse ng aking magulang para sa isang family outing.

3. Nous allons visiter le Louvre demain.

4. Sarado ang eskuwela sa Sabado at Linggo.

5. Omelettes are a popular choice for those following a low-carb or high-protein diet.

6. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

7. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

8. Inflation kann dazu führen, dass Unternehmen Schwierigkeiten haben, Kredite zu erhalten.

9. Sa tindi ng init, pakiramdam ko’y nagbabaga na ang lupa sa ilalim ng aking mga paa.

10. Lack of progress or slow progress towards a goal can also be a source of frustration.

11. Proses kelahiran di Indonesia umumnya dilakukan di rumah sakit atau pusat kesehatan masyarakat (Puskesmas).

12. Tumagal ng tatlong oras ang kanyang operasyon.

13. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

14. The new restaurant in town is absolutely worth trying.

15. The scientific community is constantly seeking to expand our understanding of the universe.

16. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

17. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

18. Humarap sakin si Nathan, Kumain na ba kayo?

19. Gusto kong ibigay ang aking buong atensyon sa aking nililigawan upang malaman niya na tunay kong mahal siya.

20. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

21. A successful father-child relationship often requires communication, patience, and understanding.

22. Ang kelangan mo na lang gawin ay mag dasal..

23. May kakaibang naramdaman ang prinsesa sa makisig na binata na iyon.

24. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

25. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

26. Ang pagiging malilimutin ni Tina ay minsang nagiging dahilan ng kanyang pagkahuli.

27. Pakidalhan mo ng prutas si Lola.

28. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

29. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

30. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

31. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

32. Ako nga pala si Nicolas, kinagagalak kitang makilala.

33. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

34. Eine schlechte Gewissensentscheidung kann zu Konflikten und Schwierigkeiten führen.

35. Ang nagmamahal sa sariling bayan, kayang magtiis at magsumikap.

36. Nació en Caprese, Italia, en 1475.

37. The doctor measured his blood pressure and diagnosed him with high blood pressure.

38. The game is played with two teams of five players each.

39. Making large purchases without consulting your budget is a risky move.

40. Napansin umano ng mga eksperto ang unti-unting pagtaas ng temperatura sa mundo.

41. Hindi dapat matakot sa mailap na mga pagsubok dahil ito ay makakapagbigay ng magandang aral.

42. Nagustuhan kita nang sobra, kaya sana pwede ba kita makilala?

43. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

44. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

45. Inutusan ng guro ang mga estudyante na ipunin ang lahat ng bola sa silid.

46. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

47. Madalas na mayroong mga organisasyon na nagsusulong ng kapayapaan at pagtigil ng digmaan.

48. Mahina ang tulo ng tubig sa kanilang pook.

49. Kaya lumaki si Pinang sa layaw.

50. Presley's influence on American culture is undeniable

Recent Searches

widetools,kabibiallottedcryptocurrencynagbungasubjectkwebangtumatakboiosdonemaayosinaloksumangnilutosarilingreservationpasangchessinisusedfredreadingibabaetocrazydigitalvasquesdaddydevicestubigbubongislaerlindailingneedsformatnakakatawacallinginformedsetsconsidermenumerehulingpotentialkidkiraninihandanaghilamoskaninumanrolledeithermabutingabut-abotworkdaynagtutulaksunud-sunurannapatinginparinpara-parangcoachingmay-bahaynasaanmagbibiyahekantahankampolipadiniibignararapattinikperangalituntuninvaledictorianbakantestartedbaku-bakongespadarenatopogimasasamang-loobdiscouragedbaotusongtasanausalangkopnagisingipapaputolpag-aagwadortsismosapakikipagbabagtinutopmaasimtobaccotanghaliannagpabotultimatelysaritanag-iisangnakarinigscientifichagdananbumahaipagbilidedication,comienzankitang-kitagantingtransmitidaslakaskalayuangusting-gustokagandabiglangwalletputingkainkauna-unahangseasitepatihimselfrememberedpinigilankaano-anoaddictionbasahinpagkikitapagkahapoarghalintuntuninmagingnaritoinalalayantechnologyromanticismoaguanami-missfuncionarbotantenangangahoykasawiang-paladtuwanewskabundukanmabangoakalayumabangmagisinggoodeveningsuwailthroughouttinataluntonmagtatagalwidespreadalwaysmagbubungataga-nayonkalawangingnecesariohitsuradagokginamitnananaginipkaninongsasakayroselleprogrammingandyanbusyanglagaslasbagkusinternalmataaasbusiness:increasesgagawinenfermedades,fueposporobilingbotetrainingjobnegosyosinisihuertoprotegidotamalinawpaghamakbakacampaignskanluranpaki-chargegivepamilyamiyerkolesisa-isanagsasagotbabalik