Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "tools,"

1. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

2. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

3. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

4. Kailangan ko ng pliers, puwede ko bang hiramin ang iyong tools?

5. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

6. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

7. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

8. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

9. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

10. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Random Sentences

1. Nagkasakit ka dahil sa kakulangan sa tulog? Kung gayon, kailangan mong magpahinga nang maayos.

2. Robusta beans are cheaper and have a more bitter taste.

3. Hindi ko akalaing may nangahas na gumawa ng ganoong delikadong eksperimento.

4. Napakaganda ng mga pasyalan sa bansang Japan.

5. Smoking is a leading cause of preventable death worldwide.

6. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

7. Sayang, kapan kita bisa bertemu lagi? (Darling, when can we meet again?)

8. Ipinagtanggol ng mga obispo ang doktrina ng purgatoryo sa kanyang homiliya.

9. Sariling pagraranas ang aking pamamagitan.

10. Twinkle, twinkle, little star.

11. Ang matanda ay nagalit at pinalayas ang bata.

12. Ikinagagalak ng pamahalaan na maghatid ng tulong sa mga nangangailangan.

13. Tila hindi siya sang-ayon sa naging desisyon ng grupo.

14. Pasensiya na kayo, wala po akong relo.

15. Halos gawin na siyang prinsesa ng mga ito.

16. La paciencia es una cualidad que se debe cultivar.

17. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

18. Ang pagiging maramot sa pagmamahal ay hindi magdudulot ng kasiyahan sa buhay.

19. Al que madruga, Dios lo ayuda.

20. Pagkatapos siyang kausapin ng hari ay dumeretso si Nicolas sa simbahan at siya ay nagdasal.

21. Ang Ibong Adarna ay nagpakita ng magagandang aral tungkol sa katapangan, pagkakaisa, at pagpapatawad.

22. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

23. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

24. Når man bliver kvinde, kan man opleve en række fysiske og følelsesmæssige forandringer.

25. Dogs can be trained for a variety of tasks, such as therapy and service animals.

26. Parang itinulos sa pagkakatayo ang mag-asawa at di malaman ang gagawin.

27. Eine Inflation kann die wirtschaftliche Ungleichheit verschärfen, da Menschen mit niedrigerem Einkommen möglicherweise nicht in der Lage sind, mit den steigenden Preisen Schritt zu halten.

28. They are not attending the meeting this afternoon.

29. Matagal-tagal ding hindi naglabada ang kanyang ina, nahihiyang lumabas sa kanilang barungbarong.

30. Hendes hår er som silke. (Her hair is like silk.)

31. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

32. El cultivo de hortalizas es fundamental para una alimentación saludable.

33.

34. Mahal ang mga bilihin sa Singapore.

35. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

36. Nanggaling ako sa loob ng sinehan at napakadilim ng paligid dahil sa matinding liwanag sa loob.

37. Matumal ang bentahan ng bulaklak ngayong lockdown.

38. Ibinigay ko ang aking buong atensyon sa kanyang mga salita upang maunawaan ang kanyang mga kahilingan.

39. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

40. Wag kang mag-alala.

41. Napansin niya ang mababa ang kita ng tindahan nitong buwan.

42. Ano ang nasa tapat ng ospital?

43. Inalalayan ko siya hanggang makarating sa abangan ng taxi.

44. Biglaan siyang nagpakita sa akin kanina nang hindi ko inaasahan.

45. The river flows into the ocean.

46. Andyan kana naman.

47. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

48. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

49. Omelettes are a popular choice for those following a low-carb or high-protein diet.

50. L'intelligence artificielle peut aider à la conception de médicaments plus efficaces.

Recent Searches

ibalikprocesomemorialfridaytools,book:kilopollutionconectandaddyibabaeyebigsumapittopic,homeworkcommunicationilaninuminstudenttheircondopangulotekstmamiphysicalbeintekaramdamanmahiyaorganizenakarinigsecarseuminomnasfigurestylescrazymarkednaggingbakeinilingbaldedosdanceplanlikelydaddoonetopracticadoimagingabslockdownareanotebookmaratinghulingeachrepresentedneverfeedbackkitsilauponfacewhyevilinfluencepang-araw-arawblessfredsquatterhimigparatingsteerarmednerissaninapagtatanimaddingdecreaseformslearningandroidtableitemswindowaffectlutuinevolvecertaintypespacestyrertoolpracticespilingbasurainlovedinmakangitinaiyakkalawakanakmahigupinsimulanag-poutpinagbigyannakauwipinatutunayanbotorabonaelenaubobinibilangmerrynobleshouldhanapbuhaygirlfriendmaestroboyetnagagamitdemocratichojasperaconvertingroletindaopoenergy-coalnamulaklakmakisigiloilonabubuhaypaboritomongunibersidadmagdamagsabihintinungodiincountryautomatiskmagsungitmahuhulimaliligonavigationpakukuluannabiglaampliabisikletaparurusahanlarrywaytagaloganumanbefolkningen,gayaiintayinliv,napaluhahetogitnakomedornaalalahugiskaramihanpakikipaglabanmagsabividenskabnagtatanimnararapattinulak-tulakamericaninformationmagpapaikotprovepinaliguanpakisabichooserestawranspendingkinainbuwalgigisingmalakingroserosasidanatinaganimokalikasanabalamurangcoachingcablepamananothercountless