Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "digital"

1. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

2. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

3. Cryptocurrency wallets are used to store and manage digital assets.

4. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

5. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

6. Las redes sociales son una parte fundamental de la cultura digital actual.

7. Money can take many forms, including cash, bank deposits, and digital currencies.

8. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

9. The rise of digital currencies and payment systems is changing the way people use and think about money.

10. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

11. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

12. This could be physical products that you source and ship yourself, or digital products like e-books or courses

13. This has led to a rise in remote work and a shift towards a more flexible, digital economy

Random Sentences

1. Ano ang pangalan ng babaeng buntis?

2. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

3. Nationalism is often associated with symbols such as flags, anthems, and monuments.

4. A través de la música, las personas expresan sus emociones, comparten sus historias y conectan con los demás

5. La música es una parte importante de la cultura española y se celebra en numerosos festivales y eventos a lo largo del año

6. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

7. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

8. Binibigyang halaga ng mga Pilipino ang talambuhay ni Ninoy Aquino bilang isang martir at simbolo ng demokrasya.

9. Ipinakita ng dokumentaryo ang mga kaso ng abuso sa mga nakakulong na bilanggo.

10. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

11. Bakit naman kasi ganun ang tanong mo! yan ang nasabi ko.

12. Las labradoras son una raza de perros muy populares en todo el mundo.

13. Les examens et les tests sont des évaluations importantes pour les étudiants.

14. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

15. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

16. Kailangan mo ng matapang na puso upang lumaban sa agaw-buhay na mundo ng negosyo.

17. Naglipana ang mga isda sa malalim na bahagi ng dagat.

18. The cough syrup helped to alleviate the symptoms of pneumonia.

19. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

20. Acara keagamaan, seperti perayaan Idul Fitri, Natal, Nyepi, dan Waisak, dihormati dan dirayakan secara luas di Indonesia.

21. Tapos nag lakad na siya papunta sa may kotse.

22. Dahil malilimutin ako, nakalimutan ko na naman ang pangalan ng bagong kaklase.

23. Banyak orang di Indonesia yang mengadopsi kucing dari jalanan atau shelter kucing.

24. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

25. Ang mahal pala ng iPhone, sobra!

26. Nag-aabang sa langit, sa mga ulap, sumisilip

27. Sa aking opinyon, isa sa mga magagaling na mang-aawit sa Pilipinas ay si Bukas Palad.

28. La science des données est de plus en plus importante pour l'analyse et la compréhension de grandes quantités d'informations.

29. They have been volunteering at the shelter for a month.

30. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

31. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

32. Nakagawian na ng prinsesang mamitas at mamasyal sa tila bang perpekting hardin para lamang sa isang prinsesang katulad niya.

33. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

34. Money can be saved and invested to achieve financial goals and build wealth.

35. Algunas heridas pueden requerir de cirugía para su reparación, como en el caso de heridas graves en órganos internos.

36. Nakatingin silang lahat sa amin, Sabay kayong maliligo?!?!

37. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

38. Gusto kong maging maligaya ka.

39. Pinanood namin ang Ifugao kahapon.

40. Nagbabaga ang kanyang mga mata habang nagsasalita, tanda ng matinding emosyon.

41. Teka bakit dinala mo ako dito sa labas?!

42. Bahagya na niyang maulinigan ang ina.

43. Salbahe ang pusa niya kung minsan.

44. Matagumpay na nagwagi si Wesley laban sa kasalukuyang kampeon ng boxing.

45. Kahit mayroon akong mga agam-agam, hindi ko ito dapat ikumpara sa iba dahil may kanya-kanyang paghihirap ang bawat isa.

46. Napapikit ako at naglabas ng malalim na himutok upang maibsan ang aking pagod.

47. Mabuti pa roon, kahit nakabilad sa init.

48. Umaasa si Carlos Yulo na mas maraming kabataan ang mahihikayat na pasukin ang larangan ng gymnastics.

49. All these years, I have been discovering who I am and who I want to be.

50. They walk to the park every day.

Recent Searches

digitalestablisimyentomaipagpatuloynabagalanhaponnagtatanimdaandecreasedelectronickanyaringmagagamitsiguromatangkadsumabogledcancerhumayomanlalakbaybinatilyonagpapaitimkaraokepaninginnaglalaroprintmusicalplasmalotnagdiskokainantumalondumikitligaligprinsipengagostokumpletopag-uwilangkayparinworrykartonsanainitlumuwaslabasharingdatingcountriesasignaturacleanrevolutionizedauthorpakitimplamakawalabagyongkwebatechniquesnamanghabarkoawaetonagtuwangadvertising,dailynatinpinakamasayaproblemapinakamatabangnakikisalomamataanyumabonggumigititagtuyotboholnaiisipilalimsuntwo-partymatagal-tagalsapagkatvehiclesthereforesearchnapahingakikilosmagta-trabaholeveragemaagaydelseraggressionbutilrestawantuhodlumagopanonoodyanhumanoikinatatakotstep-by-stepaeroplanes-allsabadongkaalamanuwakpagdiriwangtiyomagkikitatumatawapagkanag-aabangpatienceapatpaghamaknaawahigaanakotagalognakatunghaysay,matangumpaykasolosskasiyahangbunsomatagpuantrabaholikodrebolusyonfreedomsnangyaringlagunaayonmatanglumangoycompanyakongipaliwanagbalancesnapakahangaactualidadimulatmatandangsumusunodbrainlyparemerchandisewidelytumatawagkayopagsusulatkatutuboattentionpasensiyamisusedpinyaimpittungkodbatipaglipasuhogpupuntasino-sinonagsulputanmini-helicoptertingingtuminginpaanannatitiyaksandokmataomagpahabamatarikkonsyertonangangahoygutompasantinahaknatatanawpanatilihinmay-arinagaganapinisa-isamatatagbotoaalismalasutlaangkingtuyotmaalogna-curiouslahatsumamatilaanimatangosnangangaralmayaculpritfuturepasasaan