Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "partner"

1. A wife is a female partner in a marital relationship.

2. By refusing to compromise, she ended up burning bridges with her business partner.

3. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

4. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

5. Hala, change partner na. Ang bilis naman.

6. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

7. Kung maka-yo 'tong next partner ko kala mo taga kanto.

8. Ultimately, a wife is a partner and equal in a marital relationship, contributing to the success and happiness of both spouses.

Random Sentences

1. Nagsusulat ako ng mga ideya at kaisipan sa aking diary.

2. Sinong may sabi? hamon niya sa akin.

3. Omelettes are a popular choice for those following a low-carb or high-protein diet.

4. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

5.

6. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

7. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

8. Ailments can be managed through self-care practices, such as meditation or physical therapy.

9. Nagpunta kami sa peryahan kagabi.

10. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

11. The song went viral on TikTok, with millions of users creating their own videos to it.

12. Ang kamalayan sa epekto ng teknolohiya sa lipunan ay nagbubukas ng mga pinto sa masusing pagsusuri.

13. Sa ganang iyo, tama ba ang desisyong ginawa ng ating gobyerno?

14. Hindi importante kung maganda o pangit ang itsura, ang mahalaga ay hindi kababawan ng kalooban.

15. Hindi siya makabangon at makagawa ng gawaing bahay.

16. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

17. Ang ganda pala sa enchanted kingdom!

18. Sa halip na malungkot, bagkus ay nagawa pa nitong magpasalamat sa lahat ng kanyang taga-suporta.

19. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

20. Hindi ko alam kung magiging okay ka dito, pero gusto ko lang itanong - pwede ba kita ligawan?

21. Binilhan ko ng kuwintas ang nanay ko.

22.

23. Uwi na tayo.. Ayoko na dito sa ospital..

24. Naaksidente si Juan sa Katipunan

25. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

26. Ang bayang magiliw, perlas ng silanganan.

27. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

28. S-sorry. nasabi ko maya-maya.

29. Ang ganda na nang bagong Manila zoo.

30. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

31. Naglaba ang kalalakihan.

32. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

33. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

34. Sa ilalim ng malaking puno, natagpuan namin ang lilim na nagbibigay ginhawa mula sa init ng araw.

35. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

36. Good afternoon po. bati ko sa Mommy ni Maico.

37. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

38. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

39. Kung ako si Maico? Malamang magwawala ako. aniya.

40. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

41. She lost her job, and then her boyfriend broke up with her. That really added insult to injury.

42. He makes his own coffee in the morning.

43. The culprit behind the product recall was found to be a manufacturing defect.

44. Ang lamig ng yelo.

45. Después de haber viajado por todo el mundo, regresé a mi ciudad natal.

46. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

47. Elektronikken i et hjem kan hjælpe med at forbedre komfort og livskvalitet.

48. Payat siya ngunit mahahaba ang kanyang biyas.

49. Na-suway ang driver ng tricycle nang lumabag ito sa batas trapiko.

50. May limang estudyante sa klasrum.

Recent Searches

kasinggandapartnerknowsemailguerrerohinilarelevantmetodecakepinalakingferrerordernamumulamethodssambitmitigatedraft,impactedmalungkotmarahasamericakamag-anakmagnifynoonsiyentosleadingbenefitspamimilhinmanagerupworkdedicationconvertingnotmaglabataga-hiroshimakumakantasusunodnapagtantohinintaysumusunoninanaishalu-halotatloawitharap-harapangtanongniyoninalokbalancesgalitpagkabuhaymurang-murapatutunguhandisappointnanahimiknag-ugatnaliwanaganpaligsahanmaramipanindanasaankatagangsakyanincrediblepnilitsakayexperience,bigongtiningnanmatigastumingalalungsodmarkedpahirampangakomungkahimakabilipssskaarawanmalikotpaboritonganaykongsupilinlinggo-linggoipatuloyfuelsearchpumuntamoodbinigyangestiloskitangdedication,cebumind:pinunitwalletnawalanamingpalagimarasiganipinanganaknakakasulattatawagankahaponmakisuyolayuninlindoltodayumiwasililibrebansangingaymapagkalingasisentamakauuwipanunuksocomunesilagaysurroundingstondoisinumpamaniladarksagapmataasdomingoangaldoingformswindowlumakascorporationmalulungkotkinalakihannapapatungonagpapakainobserverernatuyoasukalnaantigpwestobayannakikini-kinitapotaenanagmungkahihumihingipinagsikapankinikilalanghuninagpuyosnananaghilipagpilimasayahinimpormaipagmamalakingkabundukanbusinessesnakabilipagguhitnanalotinungosaan-saantumalonnakatitignanunuribinatangdikyammalihismaayoskinantaonlysharmainemahalagadiamondisinalangnasabingaumentariconendingsabihingrestawancualquierbakitnapakagandadespitegrabenowdumatingipinagbilingklimaislandipihituponstuffeditloganiyanakilalalaki-laki