Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

52 sentences found for "ina"

1. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

2. Ang aking ina ay isang magaling na mananahi.

3. Ang aking ina ay isang magaling na mang-aawit.

4. Ang carbon dioxide ay ina-absorve ng mga puno.

5. Ang ina ay si Aling Rosa at ang anak ay si Pinang.

6. Ang masasakit na salitang binitiwan nya ay lubos na nakasakit sa kanyang ina.

7. Bagamat naghihirap ay alaga siya ng ama't ina sa masasarap na pagkain.

8. Bahagya na niyang maulinigan ang ina.

9. Baka sakaling magbago si Aya kung ito ay isa na ring ina.

10. Binibigyan niya ng halaga ang bawat oras na pinagsisikapan niya upang maging mabuting ina.

11. Dahil alam niyang galit na ang kanyang ina ay di na umimik si Pinang.

12. Dumaan ka kay Taba mamayang pag-uwi mo, narinig niyang bilin ng ina.

13. Galit na galit ang ina sa anak.

14. Gusto ng ina na matuto si Pinang ng mga gawaing bahay, ngunit laging ikinakatwiran ni Pinang na alam na niyang gawin ang mga itinuturo ng ina.

15. Habang naglalaba ang kanyang ina ay walang tigil namang naglalaro si Juanito.

16. Hinalungkat na niya ang kahong karton na itinuro ng ina.

17. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

18. Imbes na gamitin ang pana para kay Psyche, ay pinabayaan niya lamang itong mamuhay ng normal at tumaliwas sa utos ng ina.

19. Ina, huwag mo po kaming iwan! ang iyak ni Maria.

20. Inakala nga noon ng mga magulang na hindi na magkakaanak dahil matanda na ang kanyang ina pero isinilang parin siya.

21. Kitang-kita sa muka ng ina ang pagtataka dahil may dalang basket na puno ng mga gulay at prutas.

22. Laging sinusuklalyan ng kaniyang ina na si Aling Pising ang kaniyang buhok.

23. Les programmes sociaux peuvent aider à réduire la pauvreté et l'inégalité.

24. Mabait ang pamilya ni Aling Juana kaya panatag ang loob ng ama't ina ni Bereti.

25. Mahal na mahal ng ama't ina si Ranay.

26. Mahina ang kita ng kanyang ina sa paglalabada; mahina rin ang kanyang kita sa pag-aagwador.

27. Marami ang nagpasalamat dahil hindi naging kamukha ng sanggol ang kanyang ama at ina.

28. Maruming babae ang kanyang ina.

29. Masakit para sa isang ina ang sinapit ng kanyang anak ngunit masaya sa kaloobang tinanggap iyon ni Busyang.

30. Matagal-tagal ding hindi naglabada ang kanyang ina, nahihiyang lumabas sa kanilang barungbarong.

31. May iba pang sinasabi ang kanyang ina ngunit hindi na niya pinakinggan.

32. Nag tinda kahapon ang aking ina upang kami ay may makain ngayong araw.

33. Naghihinagpis ang ina sa pagkamatay ng kanyang anak na nauwi sa isang aksidente.

34. Nahigitan na nito ang kakayanan ng kanyang ama at ina.

35. Nakatingin siya sa nakasahod na balde ngunit ang naiisip niya'y ang bilin ng ina, na huwag na niyang papansinin si Ogor.

36. Nang dumalaw muli ang kanyang ama, pinatawad na niya ito at maging ang kanyang ina ay tuluyang gumaling at napatawad pa rin ang asawa.

37. Nangyari pa nagmistulang itong reyna kung utusan ang ama at ina.

38. Napadungaw ang ina at kitang-kita niya ang pagkasubasob ng anak bago paman ito nakaakyat ng hagdan.

39. Napasigaw ang naghihinagpis na ina! Hindi nito maatim ang nakikitang paghihingalo ng mga anak.

40. Noong kabuntisan ng kanyang ina sa kapatid niyang bunso ay iniwan ito ng asawa.

41. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

42. Parang nahulaan ng kanyang ina ang kanyang iniisip.

43. Payat na payat na ang ama't ina niya para matustusan ang kanyang pangangailangan.

44. Pinangaralang mabuti ng ina si Kiko na huwag uulitin ang ginawang paglapastangan nito sa punso dahil masamang magalit ang mga lamang-lupa.

45. Sa sulok ng kanyang kaliwang mata'y nasulyapan niya ang ina.

46. Samantalang ang ina naman, si Magda, siyang nag-aasikaso sa kanilang bahay at dalawang anak na sna Maria at Jose

47. Si Ogor, Impen, pahabol na bilin ng kanyang ina.

48. Tanging ina lang at kapatid niya ang kanyang kasama

49. Tinanong ang kanyang ina kung nasaan ito.

50. Tinig iyon ng kanyang ina.

51. Tuwing umagang mananaog siya upang umigib, pinagpapaalalahanan siya ng ina.

52. Walang bagay na di makita at agad tinatanong ang kanyang ina.

Random Sentences

1. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

2. Hindi ko alam kung sino ang unang naisip na bigyan ng pangalan ng Bukas Palad ang kanilang grupo ng musika, ngunit ito ay tunay na nakakainspire.

3. Maraming mga mahuhusay na maghahabi ang tumaggap sa hamon ng batang si Amba.

4. "Ang taong nagigipit, sa patalim kumakapit" ay isang bukambibig na nagpapakita ng kakayahan ng tao na gumawa ng mapanganib na mga hakbang kapag sila ay nasa kritikal na sitwasyon.

5. Bakit ka tumakbo papunta dito?

6. Mathematics provides the foundation for other sciences, such as physics and engineering.

7. Candi Borobudur di Yogyakarta adalah salah satu candi Buddha terbesar di dunia yang sangat terkenal.

8. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

9. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

10. Magkaiba ang ugali nila, si Amparo ay tamad at walang kinagigiliwang gawin kundi ang lumapit sa mga bulaklak at amuyin ito.

11. Huwag ka nanag magbibilad.

12. Umuuwi siya sa probinsiya linggo-linggo.

13. Einstein was a critic of quantum mechanics, famously declaring that "God does not play dice with the universe."

14. Sino ang bumisita kay Maria?

15. Nosotros nos disfrazamos y vamos a fiestas de Halloween durante las vacaciones.

16. Ang bata ay takot na nakatingin sa kanya.

17. Ako. Basta babayaran kita tapos!

18. Naku, may boyfriend ako eh. sabi ko.

19. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

20. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

21. Gusto kong sumama sa nanay ko sa tindahan.

22. Ang malalakas na paputok ng firecrackers ay binulabog ang kapayapaan ng gabi ng Bagong Taon.

23. Users can create and customize their profile on Twitter, including a profile picture and bio.

24. Dahil sa kahirapan natuto siyang magnakaw at mandukot

25. Omelettes are a popular choice for those following a low-carb or high-protein diet.

26. Papunta na ako dyan.

27. Ang pagguhit ay isang paraan upang mag-relax at magpakalma.

28. Ang tunay na pag-ibig sa bayan, ay hindi lamang sa panahon ng kaginhawahan.

29. Ang mga bata ay nagtatanim ng mga buto upang makita ang proseso ng paglaki ng mga halaman.

30. Muchas ciudades tienen museos de arte que exhiben obras de artistas locales e internacionales.

31. Makalipas ang siyam na buwan, isinilang ang isang napakalusog na batang babae.

32. Dahil sa sobrang init, naglipana ang mga puting ulap sa kalangitan.

33. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

34. Durante las vacaciones de otoño, visitamos viñedos para la vendimia.

35. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

36. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

37. Saan ka galing? bungad ni Maico saken pagpasok ko s condo.

38. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

39. Marami siyang kaibigan dahil palangiti siya.

40. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

41. Nous allons avoir un photographe professionnel pour immortaliser notre mariage.

42. This has led to increased trade and commerce, as well as greater mobility for individuals

43. Natapakan ako ni Juliet habang sumasayaw.

44. Pinili kong magtrabaho mula sa bahay upang makasama ang aking mga anak, bagkus may mga oras na rin na kailangan akong pumasok sa opisina.

45. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

46. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

47. El arte callejero es una forma popular de arte urbano.

48. Algunas heridas pueden requerir de cirugía para su reparación, como en el caso de heridas graves en órganos internos.

49. Ang haba ng prusisyon.

50. Umiiyak ang kanyang mga magulang ngunit alam nilang wala na silang magawa para sa bata.

Similar Words

GinangIkinagagalaksinaPilipinaspinakamahabakusinaopisinaTrinaginawaginagawaTsinapinanalunanipinanganakitinatagFilipinakinakainpinapanoodpinapakingganpinag-aaralanpinalutopinabilipinagawabitaminakinainPinapagulongminatamisInalagaanInalokpinakatuktokpinauupahangikinamatayIkinalulungkotKaninangKinapanayamsinabiIpinangangakIpinalutoipinabalikpinaggagagawapinagkakaabalahanPinaliguanPinakainnakapanghihinabinabatiminahanIkinakagalitikinagalitikinatatakotIkinasasabikIkinasuklamKinasuklamanpinaghandaanpinangyarihanpinakidalatinapayPinaghihiwaPinagbubuksanginamitpinalambotipinadalaIpinabalotpinagbigyanHinatidkaninaninaItinaponItinagokinaIpinambiliPinapinanoodLinaGinaganapTinayhapag-kainankinatatayuanInalissinasagotinasikasohinampaspinagsanglaanpinagsasasabisinabingTinawananinaabotsinagotInalalayanmahinangPinagpatuloyisinarakinalalagyanpinakamalapitInabotpinag-usapanpinahalatasinasabibinabaHinawakanTinaasbinasa

Recent Searches

inamulakumalashinatidnapakabilismataopinakamalapitpaanananimoyPaaralankayainternetmagasinnasannasaaniniuwieskuwelapresleyuminommagbakasyonkomunidaditakbayanwatawatkuwentobabygayundinkalikasanumiyakmabaitnagtrabahoiniindainisipmayabongkamibaduymagbubukidbusilaksubalithotdogkakaininlalawiganpalagayibongiyeranapaghatian1960sbiyernesPatawarinlisteningmaliksigalitmahiyatupelomalakicorakungawayairconnapatungohuwebesbatay1990kailanellarepresentedsirAgostobakaperobansamensahepamburakasaysayanmatalinomatipunongayomamimilipag-asasaan-saansakristanlumamangkinaharapmag-inanag-aabangtumakbopulubipartiesbungadnutspooktayomayroonSang-ayontanongsilamaraminayontradisyontugonpaskobilangpamamasyalangkankrusalamkapwacomputermalabodumagundongmuchitlogbusiness,supremehanggangkaawayorkidyaslapisngunitmailapMangahasnapatigilnalalabisarilibrideanimbagkuspigingnakakitamabilispantalongmatakawiwasiwasintensidadpintuanwasakpeteryepdalawinkundisharkapoykumakaindalawadekorasyonmarahillabisnagbabasaSapagkatpapansininpagdatingmostbinabaansamakatuwidmapapanatatawanapahintomakapaibabawiwanmarchkare-karekamukhamaasimmasipagginawanamingayusinmasamacreatedKinakainNatandaanmagtiismalinisnilutopasalamatangaanonaglaonmabangotangingvigtigstemaligayapag-iyakLumuwaskumaripaskababayanPalibhasaHabangdisciplinlumbaysakadadalhinTagalognakumesangrosasmagkapatidtatayode-dekorasyonnye