Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "adgang"

1. Børn bør have adgang til sunde og næringsrige fødevarer for at sikre deres sundhed.

2. Børn bør have adgang til uddannelse og sundhedsydelser uanset deres baggrund eller socioøkonomiske status.

3. Det har ændret måden, vi interagerer med hinanden og øget vores evne til at dele og få adgang til information

4. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

5. Fra telefoner til computere til tv'er, elektronik har revolutioneret måden, vi kommunikerer og får adgang til information

6. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

7. Transkønnede børn og unge skal have adgang til støtte og ressourcer til at udforske deres kønsidentitet i en tryg og støttende miljø.

8. Transkønnede personer kan opleve udfordringer i forhold til sundhedspleje og adgang til passende behandling.

Random Sentences

1. Football is known for its intense rivalries and passionate fan culture.

2. Binigyan sya ng dentista ng gamot matapos syang bunutan ng ngipin.

3. Lagi na lang lasing si tatay.

4. Simula noon ang batang si Amba ay naging unang gagamba.

5. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

6. Ang paggamit ng droga ay hindi lamang masama sa katawan, kundi pati na rin sa isipan.

7. Bakit sumakit ang tiyan ni Tonyo?

8. Después de la cena, nos sentamos a conversar en el jardín.

9. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

10. Yan ang totoo.

11. Marami pa siyang mga pangarap sa buhay at kailangan ko pa po siya.

12. Nakahiga ako sa gabi nang biglang magkaroon ng malakas na kidlat at nagitla ako sa takot.

13. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

14. Kanino humingi ng tulong ang mga tao?

15. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

16. Wag magtaka kung ikaw ay bumagsak sapagkat hindi ka naman nag-aral.

17. Nakita rin kita! ang sabi niyang humihingal

18. Tuluy-tuloy niyang tinungo ang hagdan.

19. El parto puede ser natural o por cesárea, dependiendo de las circunstancias y la salud de la madre y el bebé.

20. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

21. Masayang-masaya ang kagubatan.

22. Ang pag-asa ay maaaring magdulot ng positibong pagbabago sa buhay ng mga tao.

23. They do not skip their breakfast.

24. Hindi pa nga ako nagtatanghalian eh.

25. I used a traffic app to find the fastest route and avoid congestion.

26. Claro que puedo acompañarte al concierto, me encantaría.

27. Sinikap niyang kumbinsihin ang mga katutubo upang maging Katoliko.

28. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

29. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

30. Viruses are small, infectious agents that can infect cells and cause diseases.

31. Kinuha ko yung CP niya sa bedside table.

32. Yey! Thank you Jacky! The best ka talaga!

33. Magtatanim kami ng mga puno sa isang linggo.

34. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

35. Football coaches develop game plans and strategies to help their team succeed.

36. The exchange of rings is a common tradition in many weddings.

37. Lumingon ako para harapin si Kenji.

38. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

39. Mayroong kapatid na babae si Rosa.

40. His speech emphasized the importance of being charitable in thought and action.

41. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

42. I know they're offering free samples, but there's no such thing as a free lunch.

43. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

44. Nagtapos siya ng kolehiyo noong 1982.

45. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

46. Omelettes are a popular choice for those following a low-carb or high-protein diet.

47. Wag kang tumabi sakin! paguutos nito.

48. May mga taong may kondisyon tulad ng insomnia na nagdudulot sa kanila ng problema sa pagtulog.

49. Selvstændige medarbejdere arbejder ofte på egen hånd.

50. Tuwa at sigla ang dala ng saranggola sa bawat bata.

Recent Searches

adgangnabuoacademyikinatuwaconclusion,maskinerpaliparinmatutongpagiisippagdatingkatagalitinatagbumagsakbihasaretirarnakangitingnanigasrimascapacidadesnagkakakaininsektoligayapaki-ulitscottishsinampalpresyoiatfmaibalikhappenedpublicationkararatingtabasitodragonrailyanngpuntasportstresinakakaantaykinagabihangumandatig-bebenteuugud-ugodpierisinakripisyodaraanankasingpaghingiipantalopkastilarenacentistananalomagdaraospagkaininteligentesmakakalimutinkinabubuhaynag-aalaynaglabanalakiplaguednaiisiplarawantumawatumikimanilamaghintayyangkinaininiintaybusiness,niligawanavailablewhethermenosmag-aaralnagpuyosmaawaingtopic,anak-pawisuniversitiesluboshiramhousekatibayangbituineffectbasauniquepointextramaputicommunicatetrainingcrazyseritspinangjudicialcontestfuelfiaclientspagkabuhaytuluyanglobalisasyonibinubulongkapatawarantrippinagmamalakipalipat-lipatvasquesnapilitanwritingmag-asawangnamulatnakumbinsikumakalansingkonsentrasyongeologi,investing:traveliintayinnaghuhumindigpagkapasoklumingonlinawmagturojuegosairportpansamantalanagsuotpagkaawanakabibingingintensidadhawaiipaghaliknagngingit-ngitnagsilapitpagguhitmagtatakatennismahabangmatangumpaynataloasahanmatandangabuhingtuyoorkidyassementongkesotrentarichcoachingdontsamumapaikotdirectaroonalingnilangknownbobonapakaalatdadalosayasagothinampaskainanahhhhnagpapasasamatatalinonakinigtinitindaaaisshkambingxixmaskibestmalihischoosebalakkartonilanthroughoutsumangcondodennebayaranbinabakinatitirikanmatapobrengmultongunitsuzettegardensenior